KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516508
Entry
107516508         CDS       T06036                                 

Gene name
PDX1
Definition
(RefSeq) pancreas/duodenum homeobox protein 1
  KO
K07594  insulin promoter factor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04911  Insulin secretion
ray04930  Type II diabetes mellitus
ray04950  Maturity onset diabetes of the young
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107516508 (PDX1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107516508 (PDX1)
   04950 Maturity onset diabetes of the young
    107516508 (PDX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107516508 (PDX1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, Antp
    107516508 (PDX1)
SSDB
Motif
Pfam: Homeodomain
Other DBs
NCBI-GeneID: 107516508
NCBI-ProteinID: XP_016011801
LinkDB
Position
Unknown
AA seq 284 aa
MNGEEQYYAATQLYKDPCAFQRGAAPDLSASPPACLYMGRQPPPPPPPPPAFAGGLGALE
QGSPPDISPYEVPPLGDDAAVAHLHHHLPAPLALPLPPAGPFPDGGEPGALEEPGRVQLP
FPWMKSTKAHAWKGQWAGSAYSAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVE
LAVMLNLTERHIKIWFQNRRMKWKKEEDKKRGCGTAARGGDAEPEQDCAVTSGEELLALP
PPPPPGGAAPPAVPAAAREGRLPPGLSASPQPSSVAPLRPQEPR
NT seq 855 nt   +upstreamnt  +downstreamnt
atgaacggcgaggagcagtactacgcggccacgcagctctacaaggacccgtgcgcgttc
cagcgcggcgcggcgccggacctcagcgccagcccccctgcgtgcctgtacatgggccgc
cagcccccgccgccgccgccgccgccgcccgcgttcgccggcggcctgggcgcgctggag
cagggcagcccgcccgacatctccccgtacgaggtgccgcccctcggcgacgacgccgcg
gtggcgcacctgcaccaccacctccccgctccgctcgcgctgcccctccctcccgcgggg
cccttcccggacggaggcgagccaggcgccctggaggagcccggccgcgtgcagctgccc
ttcccgtggatgaagtccaccaaggcgcacgcgtggaaaggccagtgggcaggcagcgcg
tactcggcggagcccgaggagaacaagcggacgcgcacggcctacacgcgcgcgcagctg
ctggagctggagaaggagttcctgttcaacaagtacatctcgcgaccccgccgggtggag
ctggccgtcatgctgaacttgaccgagaggcacatcaagatctggttccagaaccgccgc
atgaaatggaaaaaggaggaggacaagaagcgcggctgcgggaccgccgcgcgcggcggc
gacgcggagcccgagcaggactgcgcggtgacctccggcgaggagctgctggcgctgccg
ccgccgccgccccccgggggtgccgcgccgcccgctgtccccgcagctgccagagagggc
cggctgcctcctggcctcagtgcgtccccgcagccctccagcgtcgcgcccctgcggccg
caggaaccccggtga

DBGET integrated database retrieval system