KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516517
Entry
107516517         CDS       T06036                                 

Gene name
OPRM1
Definition
(RefSeq) mu-type opioid receptor isoform X1
  KO
K04215  mu-type opioid receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04080  Neuroactive ligand-receptor interaction
ray04915  Estrogen signaling pathway
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107516517 (OPRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107516517 (OPRM1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107516517 (OPRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107516517 (OPRM1)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Opioid
    107516517 (OPRM1)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srx 7TM_GPCR_Srsx DUF2824
Other DBs
NCBI-GeneID: 107516517
NCBI-ProteinID: XP_016011817
LinkDB
Position
Unknown
AA seq 401 aa
MDSGTVPRNASNCTDPFTHSSSCSPAPSPGSWVNFSHLDGNLSDPCGPNRSEVGGSASLC
PPTSSPSMITAITIMALYSIVCVVGLFGNFLVMYVIIRYTKMKTATNIYIFNLALADALA
TSTLPFQSVNYLMGTWPFGTILCKIVISIDYYNMFTSIFTLCTMSVDRYIAVCHPVKALD
FRTPRNAKIINVCNWILSSAIGLPVMFMATTKYRHGSIDCTLTFSHPTWYWENLLKICVF
IFAFIMPVLIITVCYGLMILRLKSVRMLSGSKEKDRNLRRITRMVLVVVAVFIVCWTPIH
IYVIIKALITIPETTFQTVSWHFCIALGYTNSCLNPVLYAFLDENFKRCFREFCIPTSST
IEQQNSTRIRQNTRDHPSTAHTVDRTNHQLENLEAETAPLP
NT seq 1206 nt   +upstreamnt  +downstreamnt
atggacagcggcaccgtccccaggaacgccagcaactgcactgaccccttcacgcactct
tcaagttgttctccggcacctagccctggttcctgggtcaacttctcccacttagatggc
aacctgtccgacccctgcggtccgaaccgctccgaggtgggcgggagtgccagcttgtgc
cctccgaccagcagtccttccatgatcacggccatcaccatcatggccctctactccatc
gtgtgtgtggtgggtctcttcggaaacttcctggtcatgtacgtgattatcagatacacc
aaaatgaagactgccaccaacatctatatcttcaaccttgctctggcagatgccttagcg
accagtaccctgccgttccagagtgtcaactatctgatgggaacatggccgtttggaacc
atcctctgcaagatagtgatctccatagattactataacatgttcaccagcatattcacc
ctctgcaccatgagcgtcgatcgctacattgcggtctgccatcccgtcaaggccctggat
ttccgtactccccgcaatgccaaaatcatcaacgtctgcaactggatcctctcctcagcc
atcggtctgcctgtaatgttcatggcaacgaccaaatacaggcatggttccatagattgc
actctcacattctctcacccaacctggtactgggaaaacctgctgaaaatctgtgttttc
atctttgccttcatcatgcctgtcctcatcattacagtgtgctatggactgatgatctta
cgtctcaagagtgtccgtatgctctctggctccaaagaaaaggacaggaacctgcggaga
atcaccaggatggtgctggtagttgtagctgtgttcatcgtctgctggactcccattcac
atttacgtcatcattaaagccttgataacaatcccagaaactacctttcagactgtatcc
tggcatttctgcattgctcttggttacacaaacagctgcctgaacccagtcctttatgca
tttctggacgaaaacttcaaacgatgcttcagagaattctgtatcccaacttcctccacc
attgagcagcaaaactccactcgaattcgtcagaacactagagaccacccctccacggcc
catacagtggataggactaaccaccagctagaaaatctagaagcagaaactgctccattg
ccctaa

DBGET integrated database retrieval system