KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516518
Entry
107516518         CDS       T06036                                 

Gene name
FBXO5
Definition
(RefSeq) F-box only protein 5
  KO
K10292  F-box protein 5
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107516518 (FBXO5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:ray04121]
    107516518 (FBXO5)
   03036 Chromosome and associated proteins [BR:ray03036]
    107516518 (FBXO5)
Ubiquitin system [BR:ray04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   SCF complex
    Target recognizing subunit (F-box)
     107516518 (FBXO5)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Early mitotic inhibitors
    107516518 (FBXO5)
SSDB
Motif
Pfam: F-box IBR F-box-like Snu56_snRNP
Other DBs
NCBI-GeneID: 107516518
NCBI-ProteinID: XP_016011819
LinkDB
Position
Unknown
AA seq 446 aa
MSRRPCSCSPRSPSSSCRCSSSTVTAAGRPHHPHSRKEESSTLSIKMKCDFNYNCVHSGL
KLVKPDDSERLGSYTSACLKGSYKDCIKDYESLSDIGSPIGSPRIVELETESKPLHNKEN
QHVQPTLSSSDETEELDTNGPYEDSGYSSFSQQSSINEQEEASFPLEENSSDSPQSCLLQ
TQSPDQYPNKNLLPALHFAKVVCSTLKKNPKRNFKIDWEKLKKYNVNFGLQNIIGRKMGL
ECVDVLSELFGRGLRHLLANILTQLSDMDLINVSKVSTTWKKILEDDKRALQLYNEAIRR
VTEKNIKFSLHASTRENVMVRTALSSVQKAAAQPPPRKDARTKLSNPGDQEGSTYSRHNE
FSEVAKTLKKNESLKACIRCNSPAKYDGYLQRATCKREGCGFDYCTRCLCNYHTSKDCSN
GKPLKASYKMGPLPGTKKSKKNLRRL
NT seq 1341 nt   +upstreamnt  +downstreamnt
atgagccggcgcccctgcagctgctccccacgctccccatccagctcctgccgctgcagc
tccagcaccgtgacagccgccgggcgccctcatcacccgcacagtcgcaaagaagaaagt
tctactctttctatcaaaatgaagtgtgactttaactataattgtgttcattctggactt
aaactggtaaaacccgatgacagtgaaaggctaggttcctatacttctgcatgtttgaaa
ggctcttataaagattgcattaaagactacgaaagcttatcggatattgggtcaccgatt
gggagccccaggattgtagaacttgaaactgagagcaagcccttgcataataaggaaaat
cagcatgtgcaacccacacttagtagttcagatgaaacagaagaactagacacaaatgga
ccttatgaagacagtggctattcttcattttcccaacaaagtagcatcaatgaacaagaa
gaagctagctttcccctggaggaaaattccagtgacagtccacagtcttgcctgctacaa
acacaaagcccagaccaatatcccaataaaaacttgctgccagctcttcattttgcaaaa
gtggtttgttcaacattaaaaaagaatcccaaacggaattttaaaatagactgggagaag
ctgaagaagtataatgtaaattttggactacagaatataattggcaggaaaatgggccta
gaatgtgtagatgttcttagtgaactctttggacggggactcagacatctcttagcaaat
attttaacacagctcagtgatatggacttaatcaatgtgtctaaagtgagcacaacttgg
aagaagattctagaagacgataaaagggcattgcagttatacaatgaagcaatacgaaga
gttactgagaagaacataaagttctcactacatgcttcgaccagagaaaatgttatggtc
agaaccgcactgtcttctgttcaaaaagcagcagctcagcctcctcccagaaaagatgct
cgaaccaaattatccaatccaggtgatcaggaaggttctacctatagtcggcacaatgaa
ttctcggaggttgccaagactttgaaaaagaatgaaagcctcaaagcctgtattcgctgt
aattcacctgctaaatatgatggctatttacagcgggcaacctgcaaacgagaaggctgt
gggtttgattattgtacacggtgtctgtgtaattatcataccagcaaagactgctcgaat
ggcaagcccctaaaagccagttataaaatgggtcctttgcctggtactaagaaaagcaag
aagaatttacgacgattgtga

DBGET integrated database retrieval system