KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516555
Entry
107516555         CDS       T06036                                 

Gene name
PRKCD
Definition
(RefSeq) protein kinase C delta type isoform X1
  KO
K06068  novel protein kinase C delta type [EC:2.7.11.13]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04140  Autophagy - animal
ray04270  Vascular smooth muscle contraction
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04722  Neurotrophin signaling pathway
ray04750  Inflammatory mediator regulation of TRP channels
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04930  Type II diabetes mellitus
ray04931  Insulin resistance
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05020  Prion disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107516555 (PRKCD)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107516555 (PRKCD)
   04625 C-type lectin receptor signaling pathway
    107516555 (PRKCD)
   04666 Fc gamma R-mediated phagocytosis
    107516555 (PRKCD)
   04062 Chemokine signaling pathway
    107516555 (PRKCD)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107516555 (PRKCD)
   04915 Estrogen signaling pathway
    107516555 (PRKCD)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107516555 (PRKCD)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107516555 (PRKCD)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107516555 (PRKCD)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107516555 (PRKCD)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    107516555 (PRKCD)
   04931 Insulin resistance
    107516555 (PRKCD)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107516555 (PRKCD)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107516555 (PRKCD)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.13  protein kinase C
     107516555 (PRKCD)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: AGC group
  PKC family [OT]
   107516555 (PRKCD)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr C1_1 Pkinase_C zf-RING-like Kinase-like C1_2 Pkinase_fungal Zf_RING zf-RING_9 PHD DUF2318 DZR APH
Other DBs
NCBI-GeneID: 107516555
NCBI-ProteinID: XP_016011874
LinkDB
Position
Unknown
AA seq 804 aa
MGALRFIPRPFDSNQVQCSLLHWAASIVCQRSRRAETRSPQVAGKVLAGLSWPQGAGPYR
TLCGSNPATPTALQSSDEAEPGAFLWGLWAYLHEAINSWYTLLLCRFFTLSLTTIVQTLH
KNPTAGPNMAPFLRIAFNSYELGSLQATDEASQPFCAVKMKEALSTERGKTLVQKKPTMY
PEWKSTFDAHIYEGRVIQIVLMRAAEEPVSEVTVGVSVLAERCKKNNGKAEFWLDLQPQA
KVLMSVQYFLEDGDCKQSIRGEDEAMFPTMIRRGAIKQAKIHYIKNHEFIATFFRQPTFC
SVCKDFVWGLNKQGYKCRQCNAAIHKKCIDKIIGRCTGTATNSRDTIFQKERFNIDMPHR
FKVYNYMSPTFCDHCGSLLWGLVKQGLKCEDCGMNVHHKCQKKVANLCGINQKLLAEALN
QVSQRSVRKSETEPAEPFGIYQHFEKKPGVSGDDVPADNGTYGKIWEGSTRCNIENFIFH
KVLGKGSFGKVLLAELKGKKEFFAVKALKKDVVLIDDDVECTMVEKRVLALAWENPFLTH
LFCTFQTKDHLFFVMEFLNGGDLMYHIQDKGRFELYRATFYAAEIVCGLQFLHDKGIIYR
DLKLDNVMLDRDGHIKIADFGMCKENITGEKQASTFCGTPDYIAPEILQGLKYSFSVDWW
SFGVLLYEMLIGQSPFHGDDEDELFESIRVDTPHYPRWITKESKDILEKLLERDPAKRLG
VTGNIKTHPFFKTINWTLLEKRLVEPPFKPKVKSPGDYSNFDQEFLNEKARLSYSDKNLI
DSMDQTAFAGFSFVNPKFERLLEK
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgggggctctgagattcatacccagaccctttgactccaaccaagtccagtgctctctg
cttcattgggctgcctccattgtgtgccagagaagcaggagagcagaaactaggagccca
caggtggctgggaaagtcctggctggcctcagctggccccaaggagctggcccctacaga
acgctgtgtgggtccaaccctgccacccccacggccctgcagagcagcgatgaggctgag
ccaggggccttcctctggggcctgtgggcctatttgcatgaagctataaatagttggtac
accttgcttttgtgccgtttctttaccctcagcctcactaccattgttcagacactccac
aagaaccccactgcaggccccaacatggcaccattcctgcgcattgccttcaactcctac
gagctgggctccctgcaggccacagatgaggcaagccagcccttctgtgccgtgaagatg
aaggaggcactcagcacagagcgcgggaagacactggtgcagaagaagcccaccatgtac
cctgagtggaagtccacattcgacgcccacatctacgagggccgtgtcatccagatcgtg
ctgatgcgggcagccgaggagccagtgtccgaagtgacagtgggcgtgtcagtgctggcc
gagcgctgcaagaagaacaacggcaaggctgagttctggctggacctgcaaccccaggcc
aaggtgttgatgtccgtgcagtatttcctggaagatggagattgtaagcagtctattcgg
ggtgaagacgaggccatgtttccaacaatgatccggcgtggagccatcaaacaggccaaa
atccactacatcaagaaccacgagtttatcgccaccttctttaggcagcccaccttctgt
tctgtgtgcaaagattttgtctggggtctcaacaagcaaggttacaaatgcagacaatgc
aacgctgccatccataagaaatgcatcgacaagatcatcggccggtgcactggcactgcg
accaacagccgggacaccatattccagaaagaacgtttcaacattgacatgcctcaccgg
ttcaaggtttataactacatgagccccaccttctgtgaccactgtggcagcctgctctgg
ggactggtgaaacagggattaaagtgtgaagactgtggcatgaatgtgcatcacaagtgc
cagaagaaggttgccaacctctgcggcatcaaccagaagctcttggccgaggcattgaac
caagtcagccagagatccgtccggaagtcagagacagaacctgcagagccttttgggatc
taccagcattttgaaaaaaagccaggagtctctggagacgatgtcccagcagacaacggg
acctatggcaagatctgggagggcagcaccaggtgcaacattgagaacttcatcttccac
aaggtcctgggcaaaggcagcttcgggaaggtgctgcttgcagagctgaaaggcaaaaag
gaattcttcgctgtcaaggccctcaagaaggatgtagttctgatcgacgatgatgtggag
tgcaccatggtggagaagcgggtgctggcgctcgcctgggagaatccctttctcacccac
ctcttctgtaccttccagaccaaggatcacctgttcttcgtgatggagttcctcaacggg
ggagacctgatgtaccacatccaggacaaaggccgctttgagctatatcgtgccacgttt
tatgcggctgagatagtctgtggactacagtttctacatgacaaagggatcatttacagg
gacctcaagctggacaacgtgatgctggaccgggatggccacatcaaaattgctgacttc
gggatgtgcaaggagaacataactggggagaaacaggccagcaccttctgcggcactcct
gactatatcgcacctgagatcctacaaggcctgaagtactcgttctctgtggactggtgg
tcctttggagtccttctctacgagatgctcattggtcagtcccccttccacggtgacgat
gaggacgaactcttcgagtccatccgtgtggacaccccacattatccacgctggatcact
aaggagtccaaggatatcctggagaagctgcttgaaagggatccagccaagaggctggga
gtgactggcaacatcaaaacccaccccttcttcaagaccatcaactggactctgctggag
aaacgtctggtggagccacccttcaagcccaaagtgaagtcccctggagactacagcaac
tttgaccaggagttcctcaatgagaaggcgcgtctctcctacagtgacaagaacctcatc
gactccatggaccaaacagcattcgctggcttctccttcgtgaatcccaaatttgagagg
ctcctggaaaagtga

DBGET integrated database retrieval system