KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516566
Entry
107516566         CDS       T06036                                 

Gene name
CDKN1B
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01522  Endocrine resistance
ray04012  ErbB signaling pathway
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04110  Cell cycle
ray04151  PI3K-Akt signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04934  Cushing syndrome
ray05162  Measles
ray05165  Human papillomavirus infection
ray05169  Epstein-Barr virus infection
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05203  Viral carcinogenesis
ray05206  MicroRNAs in cancer
ray05215  Prostate cancer
ray05220  Chronic myeloid leukemia
ray05222  Small cell lung cancer
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107516566 (CDKN1B)
   04066 HIF-1 signaling pathway
    107516566 (CDKN1B)
   04068 FoxO signaling pathway
    107516566 (CDKN1B)
   04151 PI3K-Akt signaling pathway
    107516566 (CDKN1B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107516566 (CDKN1B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107516566 (CDKN1B)
   05202 Transcriptional misregulation in cancer
    107516566 (CDKN1B)
   05206 MicroRNAs in cancer
    107516566 (CDKN1B)
   05203 Viral carcinogenesis
    107516566 (CDKN1B)
  09162 Cancer: specific types
   05226 Gastric cancer
    107516566 (CDKN1B)
   05220 Chronic myeloid leukemia
    107516566 (CDKN1B)
   05215 Prostate cancer
    107516566 (CDKN1B)
   05222 Small cell lung cancer
    107516566 (CDKN1B)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107516566 (CDKN1B)
   04934 Cushing syndrome
    107516566 (CDKN1B)
  09172 Infectious disease: viral
   05162 Measles
    107516566 (CDKN1B)
   05169 Epstein-Barr virus infection
    107516566 (CDKN1B)
   05165 Human papillomavirus infection
    107516566 (CDKN1B)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    107516566 (CDKN1B)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 107516566
NCBI-ProteinID: XP_016011902
LinkDB
Position
Unknown
AA seq 198 aa
MSNVRVSNGSPSLERMDARQAEYPKPSACRNLFGPVNHEELTRDLEKHCRDMEEASQRKW
NFDFQNHKPLEGKYEWQEVEKSSLPEFYYRPPRPPKGACKVPAQESQDVSGNRQAVPLIG
SQANSEDTHLVDQKTDASDSQTGLAEPCTGMRKRPATDDASPQNKRANRTEENVSDASPN
AGSVEQTPKKPGLRRRQT
NT seq 597 nt   +upstreamnt  +downstreamnt
atgtcaaacgtgcgagtgtctaacgggagtccgagcttggagcggatggacgccagacag
gcggagtaccccaagccctccgcctgcagaaacctcttcggccctgtgaatcacgaagag
ttaacccgggacttggagaagcactgccgagacatggaagaggcaagccagcgcaagtgg
aattttgattttcagaatcacaagcccctggagggcaaatacgagtggcaggaggtggaa
aagagtagcttgcccgagttctactacagacccccgcggccgcccaaaggcgcctgcaag
gtgcccgcgcaggagagccaggatgtcagcgggaatcgccaggcggtgcctttaattggg
tctcaggcaaactcagaggacacgcacttggtagaccaaaaaactgatgcatcggacagc
cagacgggcttagccgagccgtgcactgggatgaggaagcgacctgcaacagacgatgcc
tctcctcaaaacaaaagagccaacagaacagaagaaaatgtgtcagatgcttccccaaac
gcgggctcagtggagcagacgcccaagaagccgggcctcagaagacgtcaaacgtaa

DBGET integrated database retrieval system