KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516772
Entry
107516772         CDS       T06036                                 

Gene name
DES
Definition
(RefSeq) desmin
  KO
K07610  desmin
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107516772 (DES)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107516772 (DES)
   05414 Dilated cardiomyopathy
    107516772 (DES)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ray04812]
    107516772 (DES)
Cytoskeleton proteins [BR:ray04812]
 Eukaryotic cytoskeleton proteins
  Intermediate filaments
   Intermediate filaments
    Type III
     107516772 (DES)
SSDB
Motif
Pfam: Filament Filament_head Spc7 GAS DUF4515 Baculo_PEP_C Trimer_CC Jnk-SapK_ap_N TolA_bind_tri DUF1664 CENP-F_leu_zip Golgin_A5 TACC_C CENP-H BLOC1_2
Other DBs
NCBI-GeneID: 107516772
NCBI-ProteinID: XP_016012344
LinkDB
Position
Unknown
AA seq 469 aa
MSQAYSSSQRVSSYRRTFGGAPAFSLGSPLSSPVFQRRGFGTKGSSSSVTSRVYQVSRTS
GGAGGLGPLRGNRLGARVSSSYGSGDLLDFSLADAVNQEFLATRTNEKVELQELNDRFAN
YIEKVRFLEQQNAALAAEVNRLKGREPTRVAEIYEEELRELRRQVEVLHNQRARVDVERD
NLLDDLQRLKAKLQEEIHLKEEAENNLAAFRGDVDAATLARIDLERRIESLNEEIAFLKK
VHEEEIRELQAQLQEQQVQVEIDTSKPDLTAALRDIRAQYETIAAQNISEAEEWYKSKVS
DLTQAANKNNDALRQAKQEMMEYRHQIQSYTCEIDALKGTNDSLMRQMRELEDRFASEAS
GYQDNITRLEEEIRHLKDEMARHLREYQDLLNVKMALDVEIATYRKLLEGEESRINLPIQ
TYSAHNFRETSPEQRGSEVHTKKTVMIKTIETRDGEVVSEATQQQHEVL
NT seq 1410 nt   +upstreamnt  +downstreamnt
atgagccaggcctactcatccagccagcgcgtgtcctcctaccgccgcaccttcggcggg
gcccccgccttctcgctgggctccccgctgagctcgcccgtgttccagcgacggggcttc
ggtaccaagggctcctcgagctcggtgacatctcgcgtgtatcaggtgtcgcgcacgtcg
ggtggggctgggggcctggggccgctgcggggcaaccggctgggggcccgcgtgtcctcc
tcctacggctcgggtgacctgctggacttctcgctggccgatgccgtgaaccaggagttc
ctggccacgcgcaccaacgagaaggtggagctgcaggaactcaatgaccgcttcgccaac
tacatcgagaaggtgcgcttcctagagcagcagaacgcggcgctcgccgccgaggtgaac
cggctcaagggccgcgagcccactcgggtcgcagagatctacgaggaggagctgcgcgag
ctgcggcgccaggtggaggtgctccacaaccagcgtgcccgtgtcgacgtggagcgtgac
aacttgctggacgacctgcagaggctcaaggccaagctgcaagaggagattcatctgaaa
gaagaagcagagaacaatttggctgccttccgaggggatgtggatgcagccactctagct
cgcattgacctggagcgtaggattgaatctctcaatgaggaaatcgcattccttaagaaa
gtgcacgaagaggagatccgagagctacaggcccagcttcaggaacaacaggtccaggta
gagatagacacgtccaagccagacctcactgccgccctcagggacatccgggcccagtac
gagaccatcgcggctcagaacatctcagaagctgaggagtggtacaagtcaaaggtgtcc
gacctgacccaggcagccaacaagaacaatgatgcactacgccaagccaagcaggagatg
atggagtatcgacaccagatccagtcctacacctgtgagatcgacgccctcaagggcact
aatgattccctgatgaggcagatgcgggagctggaggaccgctttgctagtgaagccagt
ggttaccaggacaacatcactcgcctggaggaagagattcggcacctcaaggatgagatg
gctcgccacctgcgggagtatcaggacctgctcaatgtcaagatggccctggacgtggag
attgccacctaccgaaagctgctggagggcgaagagagccggatcaacctccctatccag
acctactctgcccacaacttccgagaaacaagccctgagcaaaggggttccgaggtccat
accaagaagacagtgatgatcaagaccatcgagactcgggatggggaggtcgtcagtgag
gccacacagcagcaacacgaggtgctctaa

DBGET integrated database retrieval system