KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516884
Entry
107516884         CDS       T06036                                 

Gene name
MAP3K2
Definition
(RefSeq) LOW QUALITY PROTEIN: mitogen-activated protein kinase kinase kinase 2
  KO
K04420  mitogen-activated protein kinase kinase kinase 2 [EC:2.7.11.25]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04540  Gap junction
ray04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107516884 (MAP3K2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107516884 (MAP3K2)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107516884 (MAP3K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107516884 (MAP3K2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     107516884 (MAP3K2)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE11 family
   107516884 (MAP3K2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PB1 Kinase-like FTA2 Kdo
Other DBs
NCBI-GeneID: 107516884
NCBI-ProteinID: XP_016012551
LinkDB
Position
Unknown
AA seq 620 aa
MMDDQQALNSIMQDLAVLHKASRPALSLQETRKTKSLSPKKQNDVRVKFEHRGEKRILQF
PRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKLLL
VINGSTQATNLEPSPSLEDLDNTVFGAERKKRLSIIGPAGRDRSSPPPGYIPDELHQVAR
NGSFTSINSEGEFIPESMDQMLDPLSLSSPENSGSGSCPSLDSPLDGESYPKSRMPRAQS
YPDNHQEFSDCDNPIFEKFGKGGTYPRRYHVSYHHQEYNDGRKTFPRARRTQGTSFRSPV
SFSPTDHSLSTSSGSSTFTPEYDDSRIRRRGSDIDNPTLTVMDISPPSRSPRAPTNWRLG
KLLGQGAFGRVYLCYDVDTGRELAVKQVQFDPDSPETSKEVNALECEIQLLKNLLHDRIV
QYYGCLRDSQEKTLSIFMEYMPGGSIKDQLKAYGALTENVTRKYTRQILEGVHYLHSNMI
VHRDIKGANILRDSTGNVKLGDFGASKRLQTICLSGTGMKSVTGTPYWMSPEVISGEGYG
RKADIWSVGCTVVEMLTEKPPWAEFEAMAAIFKIATQPTNPKLPPHVSDYTRDFLKRIFV
EAKLRPSADELLRHMFVHYH
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgatggatgatcaacaagctttgaactcaatcatgcaagatttggctgttcttcataag
gccagccgaccagcattatccttacaggaaaccagaaaaacaaaatctttgtcaccaaaa
aagcagaatgatgtacgagtcaaatttgaacacagaggagaaaaaagaatccttcagttc
cccagaccagttaaactggaagatctgaggtctaaagctaaaattgcctttggacaatct
atggatctacattataccaacaatgagttggtaattccattaactacccaggatgacttg
gacaaagctgtggaactgctggatcgtagtattcatatgaagagcctcaagctattactt
gtaataaatggaagtacacaggctactaatttagaaccatcgccatcactagaagattta
gataacacagtatttggagcagagaggaaaaaacggctctctataataggtcccgctggt
agagatcgaagctcccctcccccaggatacattccagatgaattacaccaagttgcccgg
aatgggtcattcaccagtatcaacagtgaaggagagttcattccagagagcatggaccaa
atgctggacccattatctttaagcagccctgaaaattctggctcaggaagttgtccatca
ctcgatagtcctttggatggagaaagctatccaaaatcacgaatgcctagggcacagagc
tacccagataatcatcaggaattttcagactgtgataaccctatctttgagaaatttgga
aaaggaggaacatatccaagaaggtatcatgtttcatatcaccatcaagagtataatgat
ggtcgtaaaacttttccaagagctagaaggacccaggggaccagcttccggtctcctgtg
agttttagtcctactgatcactccttaagcactagtagtggaagcagtacctttacccca
gagtatgatgatagtcgaataagaagaaggggaagtgatatagacaatcctactttgact
gtaatggacatcagcccacccagccgctcacctcgtgctccaaccaactggagattgggc
aaactgctaggccagggagcctttggcagggtctacctctgttatgatgtcgatacagga
agagagttggctgttaagcaagttcaatttgaccctgatagccctgagaccagtaaggaa
gtaaatgcacttgagtgtgaaattcagttgttgaaaaacttgctgcacgaccgaattgtt
caatattatggctgtttgagggattcccaggaaaaaacactttccatatttatggaatat
atgccagggggctcaattaaggaccaattaaaagcatatggagctcttactgagaatgtg
actaggaaatacactcgtcagattctggagggtgtccattatttgcacagtaatatgatt
gttcatagagatatcaaaggggcaaatattctgcgagattcaacaggcaatgtcaaatta
ggagattttggggccagcaaacgacttcaaaccatctgtctttcgggtacaggaatgaag
tccgtcacaggcacaccatactggatgagccctgaagtgattagtggagaaggctatggc
agaaaagcagatatctggagtgtgggctgtactgtggtagaaatgttaactgaaaagcct
ccttgggcggaatttgaagcaatggctgccatctttaaaatcgccactcagccaaccaac
ccaaagctgccacctcatgtctcagactatactcgagatttcctcaaacggatctttgta
gaggccaaactgagaccttcagctgatgaactcttaaggcacatgtttgtgcactatcac
tag

DBGET integrated database retrieval system