KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516945
Entry
107516945         CDS       T06036                                 

Definition
(RefSeq) uncharacterized protein LOC107516945
  KO
K10785  T-cell receptor beta chain V region
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04064  NF-kappa B signaling pathway
ray04514  Cell adhesion molecules
ray04612  Antigen processing and presentation
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04660  T cell receptor signaling pathway
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05135  Yersinia infection
ray05142  Chagas disease
ray05144  Malaria
ray05150  Staphylococcus aureus infection
ray05162  Measles
ray05166  Human T-cell leukemia virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05202  Transcriptional misregulation in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05310  Asthma
ray05320  Autoimmune thyroid disease
ray05321  Inflammatory bowel disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107516945
   04015 Rap1 signaling pathway
    107516945
   04064 NF-kappa B signaling pathway
    107516945
   04020 Calcium signaling pathway
    107516945
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107516945
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    107516945
   04660 T cell receptor signaling pathway
    107516945
   04658 Th1 and Th2 cell differentiation
    107516945
   04659 Th17 cell differentiation
    107516945
   04672 Intestinal immune network for IgA production
    107516945
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    107516945
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107516945
  09163 Immune disease
   05310 Asthma
    107516945
   05322 Systemic lupus erythematosus
    107516945
   05323 Rheumatoid arthritis
    107516945
   05320 Autoimmune thyroid disease
    107516945
   05321 Inflammatory bowel disease
    107516945
   05330 Allograft rejection
    107516945
   05332 Graft-versus-host disease
    107516945
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107516945
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107516945
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107516945
   05150 Staphylococcus aureus infection
    107516945
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107516945
   05170 Human immunodeficiency virus 1 infection
    107516945
   05162 Measles
    107516945
   05169 Epstein-Barr virus infection
    107516945
  09174 Infectious disease: parasitic
   05144 Malaria
    107516945
   05142 Chagas disease
    107516945
SSDB
Motif
Pfam: V-set Ig_3 I-set
Other DBs
NCBI-GeneID: 107516945
NCBI-ProteinID: XP_016012672
LinkDB
Position
Unknown
AA seq 371 aa
MGTTLICWAVIWLLGTGPTSGSVTQDPRHLVVGTGQEAMLKCSPEKGHLYVYWYRRLPRE
ELKFMICLRQEEIMDQSGMPTTRYSAKFPREEPNVFKIEPAEPGDSAVYFCASSLSTPVQ
SHFLPAHKRPPRPPCTQLRTRCLLREQISSEAFGGVTMEIGQDPRSSMGHSSPCSPTRPC
HQSQPPNSTRRARGAPEPSRRCSELQGDPLPTMGNQLLCCVALCLLATGTMAGEVTQTPK
YLLIQEGREVTLECEQDFGHDAMYWYRQDPGQGLRLIYLSRIERNIEKGDLADGYSASRP
SSFPLTVTSAQQNQSALHLCASSLDTVRHSHVLSAHKCVPSPASPPGGRLSCPQDPASCF
LHLHRPQAAGS
NT seq 1116 nt   +upstreamnt  +downstreamnt
atgggcaccacgctcatctgctgggcggtcatctggctcctggggacaggtcccacgagt
ggcagcgtcacccaggacccaagacacctggtcgtggggacaggacaggaagcaatgctg
aaatgcagccccgagaaaggccacctctatgtttactggtatcggcggctcccgcgggaa
gagctgaaattcatgatttgcctccggcaagaagaaatcatggaccagtcaggaatgccg
acgacacgctattctgccaaatttcccagagaggagccgaacgtctttaagatcgagccg
gcggagccgggagactctgccgtgtacttctgtgccagctccttgtccacaccagtgcag
agtcacttcctcccagcacacaaacgtcctccgcgcccgccctgcacacagctgcggacg
cggtgtctgctcagggaacagatcagctccgaggcatttggcggggtgaccatggaaata
gggcaggaccctagaagcagcatgggacactccagcccgtgctcaccaactagaccctgt
caccagagtcagcctcccaattccacacgcagagccaggggagccccagagccttccagg
aggtgctcagagctacaaggagatccccttcccactatgggcaaccagttgctctgctgt
gtggccctctgtctcctggcaacaggcaccatggctggtgaagtcactcagaccccaaaa
tacctgctcatacaggaaggacgagaagtgaccctggaatgcgaacaggattttggccac
gacgccatgtactggtaccgacaggacccggggcaaggcctgagactcatctacctctca
cgaattgaaagaaacattgagaaaggggacctcgcagacggctacagcgcctcgcgtcct
tcgtcctttcctctcacggtgacatcggcccaacagaaccagtcagctctgcatctctgc
gccagcagcttagacacagtgaggcacagccacgtcctctccgcgcataaatgtgtccca
agccctgcttccccgccaggtggcaggctttcctgccctcaggacccggcttcctgcttc
ctccacctccaccgcccccaggctgctgggtcgtag

DBGET integrated database retrieval system