KEGG   Rousettus aegyptiacus (Egyptian rousette): 107516983
Entry
107516983         CDS       T06036                                 

Gene name
TRPV6
Definition
(RefSeq) transient receptor potential cation channel subfamily V member 6
  KO
K04975  transient receptor potential cation channel subfamily V member 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
ray04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107516983 (TRPV6)
   04978 Mineral absorption
    107516983 (TRPV6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107516983 (TRPV6)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Transient receptor potential channel (TRP)
   107516983 (TRPV6)
SSDB
Motif
Pfam: Ion_trans Ank_2 Ank Ank_3 Ank_4 Ank_5 PUB_1
Other DBs
NCBI-GeneID: 107516983
NCBI-ProteinID: XP_016012686
LinkDB
Position
Unknown
AA seq 763 aa
MGPLQREGRPGLVEASAAPRQSPVGVWPQLQPPKEPGQHDMGSPPPRKKGLLLCLWRKFC
RWFQRQEAWAQNRDEQNLLQQKRILGCPFLLAAKENDVPALSKLLQGQAWEVHQRGALGE
TALHVAALYDHLEAAAVLMEAAPELVKEPMTSELYAGQTALHVAILNQNVNLVRALLAHG
ASVSARATGTAFRLSPHNHVYFGEHPLSFAACVGSEEIVRLLIEHGADIRAQDSLGNTVL
HILVFQPNRTFACQMYNLLLSYDGRGDHPLSLDLVPNHQGLTPFKLAGVEGNAVMFQHLM
QKWKHSQGTFGLVTYTLYDLTEIDSAGDEPSLLELIVTTKKREARHILDQTPVKELVSLK
WKRYGRPYFCLLGALYVLYIVCFTMCCVYRPLKPRTDNRTQPRDNTLLQQKLLQEAYVSP
QDGIRLVGELVTVIGAVIILIFEIPDIFRVGFTRFFGHTILGGPFHVLIIAYASLVLVTM
AMRLTNTSGEVVPMSLALVLGWCNVMYFARGFQMLGPFTIMIQKMIFGDLMRFCWLMAVV
ILGFTSAFYIIFQTENPDELGHFYNYPMALFSTFEMFLTIIDGPANYDVDLPFMYSITYA
AFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVVATTVMLERKLPRCLWPRSGIFG
RDYGLGDRWFLRVEDKQDLSQRRARRYAQAFRNRGAYNPDRSWEHPRRGRAPGPSLAPAA
RSVSRSTSRGSANWGKLRQGALKSELRGVVNKGLEEEGWEYQI
NT seq 2292 nt   +upstreamnt  +downstreamnt
atggggcctctgcagagagagggcaggccaggcctcgtggaggccagtgcagccccaagg
cagagcccagtcggggtctggcctcagctgcagccccccaaggagcctggccaacacgac
atggggtcgccgccgcccaggaagaaggggctccttctctgcctgtggagaaagttctgc
agatggttccagagacaggaggcttgggctcagaaccgagacgagcagaacctgctgcag
cagaagcggatcctggggtgtcctttccttctagcggccaaggagaacgatgtcccggct
ctcagcaagctgctccagggccaggcctgggaggtgcaccagaggggagccctgggagag
acggcgctgcacgtggcggccctctacgaccatctggaagcagccgcggtgctgatggag
gctgcccccgagctggtcaaggagcccatgacgtcggagctgtatgcgggtcagacggcg
ctgcacgtggccatcttgaaccagaacgtgaacctggtgcgagccctgctcgcccacggg
gccagcgtctccgccagagccacaggcacagctttccgcctcagcccccacaaccacgtc
tactttggggagcaccctctgtcctttgccgcctgcgtgggcagcgaggagatcgtgcgg
ctgctcatcgagcacggggctgacatccgggcccaggactccctgggaaacacggtgctg
cacatcctggtcttccagcccaacaggacctttgcctgccagatgtacaacctgctgctg
tcctacgacgggcgtggggaccacccgctgtcgctggacctcgtgcccaaccaccagggc
ctcacccccttcaagctggccggagtggagggcaatgctgtgatgttccagcacctgatg
cagaagtggaagcacagccaggggacctttgggctggtgacctacaccctctatgatctc
acggagattgactcggcaggggacgagccatcgctgctggaactcatcgtcaccaccaag
aagcgggaggcccgccacatcctggaccagacgcctgtgaaggagctggtgagcctcaaa
tggaagcggtacgggcggccgtacttctgcctgctgggcgccctgtacgtgctctacatc
gtctgcttcaccatgtgctgcgtctaccgccccctcaagcccaggacggataaccgcacc
cagcccagggacaacaccctcctgcagcagaagctacttcaggaggcctacgtgagcccc
caggatggcatccgactggtgggggaactggtgactgtcattggagccgtgatcatcctg
attttcgagatcccagacatcttcagggtggggttcacacgcttcttcggacataccatc
ctcggggggccgttccatgtcctcatcatcgcttacgcctccctggtgctggtgaccatg
gcgatgcggctcaccaacaccagcggggaggtggtgcccatgtccctcgcgctggtgctg
ggctggtgcaacgtcatgtacttcgcccgaggcttccagatgctgggccccttcaccatc
atgatccagaagatgatttttggtgacctgatgcggttctgctggctgatggctgtggtc
atcctgggctttacctcagccttctatatcatcttccagacagagaacccggatgagctg
ggccatttctacaactaccccatggcgctgttcagcacctttgagatgttcctcaccatc
atcgacgggcccgccaactacgacgtggacctgcccttcatgtacagcatcacctatgcg
gccttcgccatcatcgccacgctgctcatgctcaacctcctcattgccatgatgggcgac
actcactggcgggtggcgcacgagcgggacgagctctggagggcccaggtcgtggccacc
acggtgatgctggagcggaagctgcctcgctgcctatggcctcgctctgggatctttggg
cgagattacgggctgggggaccgctggttcctgcgggtggaagacaaacaggatctcagc
cagcggcgagcccggcgctacgcacaggccttccgcaaccggggcgcctacaacccggac
agaagctgggagcacccgcggcggggccgcgcccccggccccagcctggcccctgctgcc
cgctccgtgtcgcgaagcacctcccgcggcagcgccaactgggggaaactgcggcagggg
gccctgaagtcggaactgaggggcgtggtcaacaagggcctggaggaggagggctgggag
tatcagatctga

DBGET integrated database retrieval system