KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517194
Entry
107517194         CDS       T06036                                 

Gene name
GNAQ
Definition
(RefSeq) LOW QUALITY PROTEIN: guanine nucleotide-binding protein G(q) subunit alpha
  KO
K04634  guanine nucleotide-binding protein G(q) subunit alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04015  Rap1 signaling pathway
ray04020  Calcium signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04062  Chemokine signaling pathway
ray04071  Sphingolipid signaling pathway
ray04261  Adrenergic signaling in cardiomyocytes
ray04270  Vascular smooth muscle contraction
ray04371  Apelin signaling pathway
ray04540  Gap junction
ray04611  Platelet activation
ray04713  Circadian entrainment
ray04720  Long-term potentiation
ray04723  Retrograde endocannabinoid signaling
ray04724  Glutamatergic synapse
ray04725  Cholinergic synapse
ray04726  Serotonergic synapse
ray04728  Dopaminergic synapse
ray04730  Long-term depression
ray04750  Inflammatory mediator regulation of TRP channels
ray04911  Insulin secretion
ray04912  GnRH signaling pathway
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04918  Thyroid hormone synthesis
ray04921  Oxytocin signaling pathway
ray04922  Glucagon signaling pathway
ray04924  Renin secretion
ray04925  Aldosterone synthesis and secretion
ray04927  Cortisol synthesis and secretion
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray04961  Endocrine and other factor-regulated calcium reabsorption
ray04970  Salivary secretion
ray04971  Gastric acid secretion
ray04972  Pancreatic secretion
ray05010  Alzheimer disease
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05022  Pathways of neurodegeneration - multiple diseases
ray05135  Yersinia infection
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05146  Amoebiasis
ray05163  Human cytomegalovirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    107517194 (GNAQ)
   04371 Apelin signaling pathway
    107517194 (GNAQ)
   04020 Calcium signaling pathway
    107517194 (GNAQ)
   04071 Sphingolipid signaling pathway
    107517194 (GNAQ)
   04022 cGMP-PKG signaling pathway
    107517194 (GNAQ)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    107517194 (GNAQ)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107517194 (GNAQ)
   04062 Chemokine signaling pathway
    107517194 (GNAQ)
  09152 Endocrine system
   04911 Insulin secretion
    107517194 (GNAQ)
   04922 Glucagon signaling pathway
    107517194 (GNAQ)
   04929 GnRH secretion
    107517194 (GNAQ)
   04912 GnRH signaling pathway
    107517194 (GNAQ)
   04915 Estrogen signaling pathway
    107517194 (GNAQ)
   04921 Oxytocin signaling pathway
    107517194 (GNAQ)
   04935 Growth hormone synthesis, secretion and action
    107517194 (GNAQ)
   04918 Thyroid hormone synthesis
    107517194 (GNAQ)
   04928 Parathyroid hormone synthesis, secretion and action
    107517194 (GNAQ)
   04916 Melanogenesis
    107517194 (GNAQ)
   04924 Renin secretion
    107517194 (GNAQ)
   04925 Aldosterone synthesis and secretion
    107517194 (GNAQ)
   04927 Cortisol synthesis and secretion
    107517194 (GNAQ)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    107517194 (GNAQ)
   04270 Vascular smooth muscle contraction
    107517194 (GNAQ)
  09154 Digestive system
   04970 Salivary secretion
    107517194 (GNAQ)
   04971 Gastric acid secretion
    107517194 (GNAQ)
   04972 Pancreatic secretion
    107517194 (GNAQ)
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    107517194 (GNAQ)
  09156 Nervous system
   04724 Glutamatergic synapse
    107517194 (GNAQ)
   04725 Cholinergic synapse
    107517194 (GNAQ)
   04728 Dopaminergic synapse
    107517194 (GNAQ)
   04726 Serotonergic synapse
    107517194 (GNAQ)
   04720 Long-term potentiation
    107517194 (GNAQ)
   04730 Long-term depression
    107517194 (GNAQ)
   04723 Retrograde endocannabinoid signaling
    107517194 (GNAQ)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    107517194 (GNAQ)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107517194 (GNAQ)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517194 (GNAQ)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107517194 (GNAQ)
   05016 Huntington disease
    107517194 (GNAQ)
   05017 Spinocerebellar ataxia
    107517194 (GNAQ)
   05022 Pathways of neurodegeneration - multiple diseases
    107517194 (GNAQ)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    107517194 (GNAQ)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107517194 (GNAQ)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107517194 (GNAQ)
   05163 Human cytomegalovirus infection
    107517194 (GNAQ)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107517194 (GNAQ)
   05142 Chagas disease
    107517194 (GNAQ)
   05143 African trypanosomiasis
    107517194 (GNAQ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107517194 (GNAQ)
   04031 GTP-binding proteins [BR:ray04031]
    107517194 (GNAQ)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107517194 (GNAQ)
GTP-binding proteins [BR:ray04031]
 Heterotrimeric G-proteins
  Alpha Subunits
   Alpha type 3 (Gq/11) [OT]
    107517194 (GNAQ)
SSDB
Motif
Pfam: G-alpha Arf Gtr1_RagA TniB AAA_29
Other DBs
NCBI-GeneID: 107517194
NCBI-ProteinID: XP_016013126
LinkDB
Position
Unknown
AA seq 359 aa
MTLESIMACCLSEEAKEARRINDEIERQLRRDKRDARRELKLLLLGTGESGKSTFIKQMR
IIHGSGYSDEDKRGFTKLVYQNIFTAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEK
VSAFENPYVDAIKSLWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPAYLPTQQDVL
RVRVPTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYDQVLV
ESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYSHLVDYFPEYDGPQR
DAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTENIRFVFAAVKDTILQLNLKEYNLV
NT seq 1080 nt   +upstreamnt  +downstreamnt
atgactctggagtccatcatggcgtgctgcctgagcgaggaggccaaggaagcccggcgg
atcaacgacgagatcgagagacagctccgcagggacaagcgggacgcccgccgggagctc
aagctgctgctgctggggacaggagagagtggcaagagtacatttatcaagcaaatgaga
atcatccacgggtcgggatactccgatgaagacaaaaggggcttcaccaagctggtgtac
cagaacatcttcacggccatgcaggctatgatcagagccatggacacgctcaagatcccc
tacaagtacgagcacaataaggctcatgcacaattagttcgagaagtcgatgtggagaag
gtgtctgcttttgagaatccatacgtagatgcaataaagagtttatggaatgatcctgga
atccaggaatgctatgatagacgacgagaatatcagctatctgactctaccaaatactat
cttaatgacttggaccgcgttgctgaccctgcctacctgcctacgcaacaagatgtgctt
agagttcgagtccccaccacagggatcatcgaatacccctttgacttacaaagtgtcatt
ttcagaatggtcgatgtagggggccaaaggtcagagagaagaaaatggatacactgcttt
gaaaatgtcacctctatcatgtttctagtagcgcttagtgaatatgatcaagttctcgtg
gaatcggacaatgagaaccgaatggaggaaagcaaagcactctttagaacaattatcaca
tatccctggttccagaactcctcggttattctgttcttaaacaagaaagatcttctagag
gaaaaaattatgtattcccacctagttgactacttcccagaatatgatggaccccagaga
gatgcccaagcagctcgagaattcatcctgaagatgttcgtggacctgaatccagacagt
gacaaaattatctactcccacttcacatgcgccacagataccgagaacatccgctttgtc
tttgctgctgtcaaggacaccatcctccagttgaacctgaaggagtacaatctggtctaa

DBGET integrated database retrieval system