KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517268
Entry
107517268         CDS       T06036                                 

Gene name
RASGRP2
Definition
(RefSeq) RAS guanyl-releasing protein 2 isoform X1
  KO
K12361  RAS guanyl-releasing protein 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04062  Chemokine signaling pathway
ray04611  Platelet activation
ray05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107517268 (RASGRP2)
   04014 Ras signaling pathway
    107517268 (RASGRP2)
   04015 Rap1 signaling pathway
    107517268 (RASGRP2)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107517268 (RASGRP2)
   04062 Chemokine signaling pathway
    107517268 (RASGRP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517268 (RASGRP2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107517268 (RASGRP2)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   107517268 (RASGRP2)
SSDB
Motif
Pfam: RasGEF EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 C1_1 RasGEF_N EF-hand_8
Other DBs
NCBI-GeneID: 107517268
NCBI-ProteinID: XP_016013310
LinkDB
Position
Unknown
AA seq 608 aa
MAGTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLAAKLLHIY
QQSRKDNSSSLQVKTCHLVRYWISAFPAEFDLNHELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPMEQKKRKMSLLFDHLEPLELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTAPQRALVITHFVHVAEKLLQLQNF
NTLMAVVGGLSHSSISRLKDTHSHVSPETIKLWEGLTELVTATGNYGNYRRRLAACAGFR
FPILGVHLKDLVALQLALPDWLDPARTRLNGAKMKQLFSILEELAMVTSVRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRAPVLEEWTAAAKPKLDQ
ALMVEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
VSYFLRSSSVLGGRMGFVHNFHESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KDRLSVECRRRAQSMSLEGSAPSPSPTHTHHRAFSFSLPRPGRRGSRPPEIREEEVQTVE
DGVFDIHL
NT seq 1827 nt   +upstreamnt  +downstreamnt
atggcgggcaccctagacctggacaagggctgtacggtggaagagctgctccgcggctgc
attgaagcctttgatgactccgggaaggtgcgagacccgcagctggtgcgcatgttcctc
atgatgcacccctggtacatcccttcctctcagttggcggcaaaactgcttcacatttac
caacaatcccggaaggacaactccagttcactgcaggtgaaaacatgccacttggtcagg
tactggatctcagcattcccagcagagttcgacttgaaccatgagctcgctgagcagatc
aaggagctgaaggctctgctggaccaagaagggaaccggcggcacagcagcctcatcgac
atcgagagcgtccccacatacaagtggaagcggcaggtgacccagcggaaccccatggaa
cagaagaagcgcaagatgtccctgttgttcgaccacctggagcccttggagctggcggag
catctcacttacctggagtatcgctcgttctgcaagatcctgttccaggactatcacagt
ttcgtgactcacggctgcaccgtggacaaccctgtcctggagcgattcatctccctcttc
aacagtgtctcccagtgggtgcagctcatgattctcagcaagcccacggccccacagcgg
gccctggtcatcacgcacttcgtccacgtggcagagaagctgctgcagctgcagaacttc
aacacgctaatggcagtagtcgggggcctgagccacagctccatctcccgcctcaaggat
acccacagccacgtcagccctgagaccatcaagctctgggaaggtctgacagaattagtg
acggccactggcaactatggcaactaccggcgccggctggcagcctgtgcgggcttccgt
ttccccatcctgggtgtgcacctcaaagacctggtggccctgcagctggcattgcctgac
tggctggaccctgcccggacccgactcaatggggccaagatgaagcagctcttcagcatc
ctggaggagctggccatggtgaccagcgttcggccaccagtgcaggccaaccctgacctg
ctgagcctgctcacggtgtctctggatcagtatcagacggaagatgagctctaccagctg
tccctgcagagggagccacgctccaagtcctcgccaaccagccctacgagctgcacccca
ccgccccgggccccagtgctggaggagtggactgcagctgccaaacccaagctggatcag
gcactcatggtggaacacattgagaaaatggtggagtctgtgttccggaactttgatgtc
gatggagacggccacatctcacaggaagagttccagatcatccgtgggaacttcccttac
ctcagcgcctttggggacctggaccagaaccaggatggctgcatcagcagggaggagatg
gtctcctacttcctgcgctccagctccgtgctgggaggccgcatgggcttcgtacacaac
ttccacgagagcaactccttacgtccggttgcctgccgccactgcaaggccctgatcctg
ggcatctacaagcagggcctcaaatgccgagcctgtggcgtgaactgccacaagcagtgc
aaggatcgcctgtcagttgagtgccggcgccgggcccagagcatgagtctggaggggtct
gcaccctcgccctcacccacacacacccaccatcgggccttcagcttctccctgccccgc
cccggcaggcgaggctcccggcctccagagatccgagaagaggaggtacagactgtggag
gatggtgtgtttgacatccacttgtaa

DBGET integrated database retrieval system