KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517367
Entry
107517367         CDS       T06036                                 

Gene name
PDE2A
Definition
(RefSeq) cGMP-dependent 3',5'-cyclic phosphodiesterase isoform X1
  KO
K18283  cGMP-dependent 3',5'-cyclic phosphodiesterase [EC:3.1.4.17]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00230  Purine metabolism
ray01100  Metabolic pathways
ray04022  cGMP-PKG signaling pathway
ray04740  Olfactory transduction
ray04925  Aldosterone synthesis and secretion
ray05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    107517367 (PDE2A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107517367 (PDE2A)
 09150 Organismal Systems
  09152 Endocrine system
   04925 Aldosterone synthesis and secretion
    107517367 (PDE2A)
  09157 Sensory system
   04740 Olfactory transduction
    107517367 (PDE2A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    107517367 (PDE2A)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     107517367 (PDE2A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 GAF_3
Other DBs
NCBI-GeneID: 107517367
NCBI-ProteinID: XP_016013460
LinkDB
Position
Unknown
AA seq 940 aa
MGQACGHSILCRSQQYPAARPAEPRGQQVFLKPDEQPPPPCADSLQDALLSLGSVINTAG
LHRAVKEALSAVLPRVETVYTYLLDRESRLVCEDPPHELPQEGKVREAVISQKRLGCNGL
GLSDLQGKTLAKLVAPLAPDTQVLVIPLVDKEAGAVAAVILVHCGQLSDSEEWSLQAVEK
HTLVALRRVQALQQRGSGAAPEAAQNPPAGTAGDQKGGVAYTDQDRKILQLCGELYDLDA
SSLQLKVLQYLQQETQASRCCLLLVSEDNLQLSCKVIGDKVLEEEISFPLTMGHLGQVVQ
DKKSIQLKDLTSEDVQQLQSMLGCELQAMLCVPVISRATDQVVALACAFNKLGGDLFTDQ
DEHIIQHCFHYTSTVLTSTLAFQKEQKLKCECQALLQVAKNLFTHLDDVSVLLQEIITEA
RNLSNAEICSVFLLDQNELVAKVFDGGVVEDESYEIRIPADQGIAGHVATTGQILNIPDA
YAHPLFYRGVDDSTGFRTRNILCFPIKNENQEVIGVAELVNKINGPWFSKFDEDLATAFS
IYCGISIAHSLLYKKVNEAQYRSHLANEMMMYHMKVSDDEYTKLLHDGIQPVAAIDSNFA
SFTYTPRSLPEDDTSMAILSMLQDMNFINNYKIDCPTLARFCLMVKKGYRDPPYHNWMHA
FSVSHFCYLLYKNLELTNYLEDIEIFALFVSCMCHDLDHRGTNNSFQVASKSVLAALYSS
EGSVMERHHFAQAIAILNTHGCNIFDHFSRKDYQRMLDLMRDIILATDLAHHLRIFKDLQ
KMADVGYDRTNKQHHSLLLCLLMTSCDLSDQTKGWKTTRKIAELIYKEFFSQGDLEKAMG
NRPMEMMDREKAYIPELQISFMEHIAMPIYKLLQDLFPKAAELYERVASNREHWTKVSHK
FTIRGLPSNNSLDFLDEEYEVPELDGTRGPVNGCCSLDTE
NT seq 2823 nt   +upstreamnt  +downstreamnt
atggggcaggcatgcggccactccatcctctgcaggagccagcagtacccggcagctcgg
ccggctgagccgcggggccagcaggtcttccttaagccggacgagcagccgccgccgcca
tgcgccgacagccttcaggatgctttgctgagcctgggctccgtcatcaatactgcaggt
ttgcaccgggctgtcaaggaggccctctcggccgtgcttcccagagtggagacggtctac
acctacctgctggacagggagtcccggctggtgtgtgaggaccctccacatgagctgccc
caggaggggaaggtccgagaggccgtgatctcccagaagcggctgggctgcaatggactg
ggtctttcagacctgcagggaaaaactttggccaagctggtagctccactggctcctgac
acccaagtgctggtcataccgctggtggacaaggaggctggggctgtggcagccgtcatc
ttggtgcactgtggccagctgagtgacagtgaagagtggagccttcaagccgtggagaag
cataccctggtagccctgcgaagggtgcaggccctgcagcagcgcggatctggcgcggcc
cccgaagctgcccagaaccctccagcggggactgcaggagatcagaagggcggtgtcgct
tacactgaccaggaccgaaagatcctgcaactgtgcggggaactctatgacctggatgcc
tcttccctgcagctcaaagtcctccaatacctgcaacaggagacccaggcatcccgctgc
tgccttctgctggtgtctgaagacaatctacagctctcctgtaaggtcattggagataaa
gtgctggaagaagagatcagcttcccgttgacgatgggacacctgggccaagtggtacaa
gataagaagtctatccagctgaaagatctcacttctgaggatgtgcaacagctgcaaagc
atgttgggttgtgagcttcaggccatgctctgtgtccctgtcatcagccgggctactgac
caggtggtggccttggcctgcgctttcaacaagcttggaggagacttattcacggaccag
gatgaacacatcatccaacactgcttccactacaccagcacggtgctcaccagcaccctg
gcctttcagaaggagcagaagctcaagtgtgagtgccaggctcttctccaagtggcaaag
aacctcttcactcacctggatgacgtctctgtcctgctccaggagatcatcacagaggcc
agaaacctcagcaacgctgagatctgttcagtgttcctgctggatcagaatgagctggtg
gccaaggtgttcgacgggggcgtggtggaggacgagagctatgagatccgcatcccagcc
gaccagggcatcgcgggccacgtggcgaccacgggccagatcctgaacattcctgatgcg
tatgcacatccgcttttctaccgtggcgtggacgacagcactggcttccgcacgcgcaac
atcctttgctttcccattaagaatgagaaccaggaggtcatcggtgtggcagagctggtg
aacaagatcaacggaccatggttcagcaagttcgatgaggacctggccactgccttctcc
atctactgcggcatcagcatcgcccattccctcctttacaagaaagtgaatgaggcccag
tatcgcagccacctcgccaacgagatgatgatgtaccacatgaaggtttctgatgacgaa
tacaccaaactcctccatgacgggatccagcctgtggctgccattgactccaactttgcc
agttttacctatacccctcgctctctaccagaggatgacacatccatggccatcttgagc
atgctgcaagacatgaatttcatcaacaactacaaaatcgactgcccaacactggcccga
ttctgtctgatggtgaagaagggctaccgggatcccccttatcacaactggatgcatgcc
ttctctgtctcccacttctgctacctgctctacaagaacctggagctcaccaactacctc
gaggacatcgagatatttgccttgtttgtttcctgcatgtgtcatgacctggaccacaga
ggcacaaacaattctttccaagtggcctcgaaatctgtactggccgcgctctatagctcc
gagggctctgtcatggagaggcaccacttcgctcaagccatcgccatcctcaacacccac
ggttgcaacatctttgaccacttctcccgaaaggactatcagcgcatgttggacctgatg
cgggacatcatcttggccaccgacctggcccaccaccttcgcatctttaaggatctccag
aagatggctgacgtgggctatgaccgaactaacaagcagcaccatagtctcctcctttgc
ctccttatgacctcctgtgacctctctgaccagaccaagggctggaagaccacaaggaag
attgcagagctgatctacaaagagttcttctcccagggagacttggagaaagccatgggc
aacaggccaatggagatgatggaccgtgagaaggcttacattcctgagctgcagatcagc
ttcatggagcacatcgcaatgcccatctacaagctgctgcaggacctgttccctaaagca
gcagagctgtatgaacgtgtggcctctaaccgtgagcactggaccaaggtgtcccacaag
ttcaccatccgcggcctcccaagcaacaactcgctggacttcttggatgaggaatacgag
gtccctgagctggatggcactaggggccctgtcaatggctgttgcagccttgacactgag
taa

DBGET integrated database retrieval system