KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517401
Entry
107517401         CDS       T06036                                 

Gene name
MAP2K4
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04620  Toll-like receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04912  GnRH signaling pathway
ray04926  Relaxin signaling pathway
ray04935  Growth hormone synthesis, secretion and action
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05142  Chagas disease
ray05161  Hepatitis B
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107517401 (MAP2K4)
   04012 ErbB signaling pathway
    107517401 (MAP2K4)
   04668 TNF signaling pathway
    107517401 (MAP2K4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107517401 (MAP2K4)
   04664 Fc epsilon RI signaling pathway
    107517401 (MAP2K4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107517401 (MAP2K4)
   04926 Relaxin signaling pathway
    107517401 (MAP2K4)
   04935 Growth hormone synthesis, secretion and action
    107517401 (MAP2K4)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107517401 (MAP2K4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107517401 (MAP2K4)
   05135 Yersinia infection
    107517401 (MAP2K4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107517401 (MAP2K4)
   05161 Hepatitis B
    107517401 (MAP2K4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107517401 (MAP2K4)
   05169 Epstein-Barr virus infection
    107517401 (MAP2K4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    107517401 (MAP2K4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107517401 (MAP2K4)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107517401 (MAP2K4)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE7 family
   107517401 (MAP2K4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107517401
NCBI-ProteinID: XP_016013557
LinkDB
Position
Unknown
AA seq 411 aa
MSFPTTGEDDQSGYHSSFFKLYFILPKNHSNENLKREKQGFQINFCEKAQSKRKALKLNF
ANPPFKSTARFTLNPNPTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEI
GRGAYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGAL
FREGDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHR
DIKPSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRS
DVWSLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCL
TKDESKRPKYKELLKHPFILMYEERTVEVASYVCKILDQMPATPSSPMYVD
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgtcgttccctactacaggggaagatgatcaaagtggataccacagcagctttttcaag
ctgtatttcatcttaccaaaaaatcactcaaatgaaaatttaaaaagggaaaaacaaggc
tttcagataaacttctgtgaaaaggcacaaagtaaacgcaaagcactgaagttgaatttt
gcaaatccacctttcaaatctacagcaaggtttactctgaatcccaatcctacaggagtt
caaaacccacacatagagagactgagaacacacagcattgaatcgtcaggaaaactgaag
atctcccctgaacaacactgggatttcactgcagaggacttgaaagaccttggagaaatt
ggacgaggagcttatggttctgtcaacaaaatggtccacaaaccaagtgggcaaattatg
gcagttaaaagaattcggtcaacagtggatgaaaaagaacaaaaacaacttcttatggat
ttggatgtagtaatgcggagtagtgattgcccgtacattgttcagttttatggtgcactc
ttcagagagggtgactgttggatctgtatggaactcatgtctacctcgtttgataagttt
tacaaatatgtatatagtgtattagatgatgttattccagaagaaattttaggaaaaatc
actttagcaactgtgaaagcactaaaccacttaaaagaaaacttgaaaatcattcacaga
gatatcaaaccttccaatatccttctggacagaagtggaaatattaaactctgtgacttt
ggcatcagtggacagcttgtggactccattgccaagacaagagatgctgggtgtaggcca
tacatggcacctgaaagaatagacccaagtgcatcgcgacaaggatatgatgttcgctct
gatgtctggagtttggggatcacattgtacgagctggccacaggccgatttccttatcca
aagtggaatagtgtatttgatcaactaacacaagtcgtgaaaggagatcctccacagctg
agtaattctgaggaaagggaattctccccaagtttcatcaactttgtcaacttgtgcctt
acaaaggacgaatccaaaaggccaaagtataaagaacttctgaaacatccctttattttg
atgtatgaagaacgtaccgtagaggttgcaagctatgtttgtaaaatcctggatcaaatg
ccagctactcccagctctcccatgtatgttgattga

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519926
Entry
107519926         CDS       T06036                                 

Gene name
MAP2K7
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 7 isoform X1
  KO
K04431  mitogen-activated protein kinase kinase 7 [EC:2.7.12.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04141  Protein processing in endoplasmic reticulum
ray04380  Osteoclast differentiation
ray04530  Tight junction
ray04620  Toll-like receptor signaling pathway
ray04660  T cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04668  TNF signaling pathway
ray04722  Neurotrophin signaling pathway
ray04912  GnRH signaling pathway
ray04926  Relaxin signaling pathway
ray05010  Alzheimer disease
ray05016  Huntington disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05135  Yersinia infection
ray05161  Hepatitis B
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107519926 (MAP2K7)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519926 (MAP2K7)
   04012 ErbB signaling pathway
    107519926 (MAP2K7)
   04668 TNF signaling pathway
    107519926 (MAP2K7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107519926 (MAP2K7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107519926 (MAP2K7)
   04660 T cell receptor signaling pathway
    107519926 (MAP2K7)
   04664 Fc epsilon RI signaling pathway
    107519926 (MAP2K7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    107519926 (MAP2K7)
   04926 Relaxin signaling pathway
    107519926 (MAP2K7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    107519926 (MAP2K7)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107519926 (MAP2K7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107519926 (MAP2K7)
   05016 Huntington disease
    107519926 (MAP2K7)
   05022 Pathways of neurodegeneration - multiple diseases
    107519926 (MAP2K7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107519926 (MAP2K7)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107519926 (MAP2K7)
   05135 Yersinia infection
    107519926 (MAP2K7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107519926 (MAP2K7)
   05161 Hepatitis B
    107519926 (MAP2K7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519926 (MAP2K7)
   05169 Epstein-Barr virus infection
    107519926 (MAP2K7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107519926 (MAP2K7)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     107519926 (MAP2K7)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE7 family
   107519926 (MAP2K7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal APH
Other DBs
NCBI-GeneID: 107519926
NCBI-ProteinID: XP_016018640
LinkDB
Position
Unknown
AA seq 435 aa
MAASSLEQKLSRLEAKLKQENREARRRIDLNLDISPQRPRPIIVITLSPAPAPSQRAALQ
LPLANDGGSRSPSSESSPQHPTPPARPRHMLGLPSTLFTPRSMESIEIDQKLQEIMKQTG
YLTIGGQRYQAEINDLENLGEMGSGTCGQVWKMRFRKTGHVIAVKQMRRSGNKEENKRIL
MDLDVVLKSHDCPYIVQCFGTFITNTDVFIAMELMGTCAEKLKKRMQGPIPERILGKMTV
AIVKALYYLKEKHGVIHRDVKPSNILLDERGQIKLCDFGISGRLVDSKAKTRSAGCAAYM
APERIDPPDPTKPDYDIRADVWSLGISLVELATGQFPYKNCKTDFEVLTKVLQEEPPLLP
SHMGFSGDFQSFVKDCLTKDHRKRPKYNKLLEHSFIKRYETLEVDVASWFKDVMAKTESP
RTSGVLSQHHLPFFR
NT seq 1308 nt   +upstreamnt  +downstreamnt
atggcggcgtcctccttggagcagaagctgtcccgcctggaagcaaagctgaagcaggag
aaccgcgaggcccggcggaggatcgacctcaacctggatatcagcccccagcggcccagg
cccattattgtgatcactctaagccctgctcctgccccgtcccaacgagcagccctgcag
ctcccactggccaatgatggcggcagccgctcaccgtcctctgagagctccccgcagcac
cctacgccccctgcccggccccgtcacatgctggggctcccgtctaccttgttcacaccc
cgcagcatggagagcattgaaattgatcagaagctgcaggagatcatgaagcagacaggc
tacctgaccatcggcggccagcgctaccaggcagaaatcaacgacctggagaacctgggg
gagatgggcagcggcacctgtggccaggtgtggaagatgcgcttccggaagacaggccat
gtcatcgccgtcaagcaaatgcggcgctctgggaacaaggaagagaacaagcggatcctc
atggacctggatgtggtgctcaagagtcatgattgcccctacatcgtgcagtgcttcggg
accttcatcaccaatacagacgtcttcattgccatggagctgatgggcacatgtgccgag
aagctgaagaagcggatgcagggccccatccctgagcggatcctgggcaagatgaccgtg
gcgattgtgaaggcgctctattacctgaaggagaaacatggtgtgatccaccgggatgtc
aagccttctaacatcttgctggatgaacggggccagatcaaactctgtgactttggcatc
agcggccgtctcgttgactccaaggccaaaactcggagtgccggctgcgccgcctacatg
gcacctgagcgtattgatcccccggaccccactaaaccagactatgacatccgggctgac
gtgtggagcttgggcatctccctggtggagctggcgacaggacaatttccctacaagaac
tgcaagacggacttcgaggtcctcaccaaggtcctgcaggaagagcccccactcctgccc
agtcacatgggcttctcgggggactttcagtccttcgtcaaagactgccttactaaagat
cacagaaagagaccaaagtataataagctacttgaacacagcttcattaagcgctatgag
acgctggaagtagatgtggcgtcctggttcaaggatgtcatggcaaagaccgagtcaccg
cggactagtggagtcctgagccaacaccacctgcccttcttcaggtag

DBGET integrated database retrieval system