KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517455
Entry
107517455         CDS       T06036                                 

Gene name
TNFSF11
Definition
(RefSeq) LOW QUALITY PROTEIN: tumor necrosis factor ligand superfamily member 11
  KO
K05473  tumor necrosis factor ligand superfamily member 11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04064  NF-kappa B signaling pathway
ray04380  Osteoclast differentiation
ray04917  Prolactin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray05224  Breast cancer
ray05323  Rheumatoid arthritis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107517455 (TNFSF11)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107517455 (TNFSF11)
 09150 Organismal Systems
  09152 Endocrine system
   04917 Prolactin signaling pathway
    107517455 (TNFSF11)
   04928 Parathyroid hormone synthesis, secretion and action
    107517455 (TNFSF11)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107517455 (TNFSF11)
 09160 Human Diseases
  09162 Cancer: specific types
   05224 Breast cancer
    107517455 (TNFSF11)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107517455 (TNFSF11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107517455 (TNFSF11)
   04090 CD molecules [BR:ray04090]
    107517455 (TNFSF11)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Tumor necrosis fators
   107517455 (TNFSF11)
CD molecules [BR:ray04090]
 Proteins
  107517455 (TNFSF11)
SSDB
Motif
Pfam: TNF
Other DBs
NCBI-GeneID: 107517455
NCBI-ProteinID: XP_016013674
LinkDB
Position
Unknown
AA seq 318 aa
MRRASRDCTKYLRAEEDMDGGGPGAPHEGPPHAPPPAAPHQPAAASRSVFLALLGLGLGQ
VVCRRRPVPLLRAQMDPNRISEDDTHCINRIFKLHENADLQDASLETQDTKLIPDSCKRI
KQAFQAAVQKELQHIVRSQHIRAEKATVDGSWLDLARRGKPDTQPFAHLTINATDIPSGS
HKVSLSSWYHDRGWAKISNMTFSNGKLRVNQDGFYYLYANICFRHHETSGILARAYLQLM
VYVTKTSIKIPSSHTLMKGGSTKYWSGDSEFHFYSINVGGFFKLRSGEEISIEVSNPSLL
DPDQDATYFGAFKVRDID
NT seq 957 nt   +upstreamnt  +downstreamnt
atgcgccgcgccagccgagactgcaccaagtacctgcgcgccgaggaggacatggacggc
ggcgggcccggcgccccgcacgagggccccccgcacgccccgccgcccgccgcgccgcac
cagcccgccgccgcctcgcgctccgtgttcctggctctgctggggctggggctgggccag
gtggtctgcaggcgtcgccctgttcctctacttcgagcgcagatggatcctaatagaata
tcggaagatgacactcactgcattaacagaattttcaaactccacgagaacgcggatttg
caagacgcaagtctggagactcaggacacgaaactgatacctgattcgtgcaagagaatt
aaacaggcttttcaagcagctgtgcagaaggaattacaacatattgttagatcccaacac
atcagagcagaaaaagctacggtagacggttcctggttagatctggccaggaggggcaag
ccggatactcaaccttttgctcatctcaccattaatgccactgacatcccgtcaggttcc
cacaaagtgagcctgtcttcctggtaccacgaccgaggttgggccaagatctccaacatg
actttcagcaatggaaaactaagagtcaaccaagatggcttctattacctctacgctaac
atttgctttcgacatcacgaaacttcgggaatcctcgccagagcgtatcttcagctgatg
gtgtacgtcacgaaaaccagcatcaaaatccccagttctcacaccctgatgaaaggagga
agcaccaaatactggtcgggggactccgaattccatttttactccataaacgttggaggc
ttttttaagttacgatccggtgaggaaataagcatcgaggtgtccaacccttcgctgctg
gatccagatcaagacgcaacgtactttggggcttttaaagttcgagatatagattga

DBGET integrated database retrieval system