KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517463
Entry
107517463         CDS       T06036                                 

Gene name
AR
Definition
(RefSeq) androgen receptor
  KO
K08557  androgen receptor
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04114  Oocyte meiosis
ray05200  Pathways in cancer
ray05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    107517463 (AR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517463 (AR)
  09162 Cancer: specific types
   05215 Prostate cancer
    107517463 (AR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107517463 (AR)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107517463 (AR)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 estrogen receptor-like
    107517463 (AR)
Nuclear receptors [BR:ray03310]
 3. Estrogen like
  3C. 3-Ketosteroid receptor
   107517463 (AR)
SSDB
Motif
Pfam: Androgen_recep Hormone_recep zf-C4
Other DBs
NCBI-GeneID: 107517463
NCBI-ProteinID: XP_016013685
LinkDB
Position
Unknown
AA seq 901 aa
MEVQLGLGRLYPRPPSKTYRGAFQNLFQSVREVIQTPGPRHPEPASAAPPGARLQQQQQQ
QQQQPRRRRESSSGRQQQQQGDDGSPQSQGRCPAGYLALEQEPQPAQHQSAPEGHADSGC
LPEPGAAAGKGLPPPPPAPPDEDDSAAPSTLSLLGPTFPGLSGCSANLKDILSEAGSMQL
LQPPPQPPQPPQQEATSEGGSGGRAREAAGAPTSSKDSYLAGSSTISDSAKELCKAVSVS
MGLGVESLEHLGPGEQLRGDCMYAPLLGGPPAVRPAACTQLAECKGSLLDERPSKGAEET
SDYPPFKAGYAKALDGDSLGCPGGGEAEVSGPLELPSSLSLYKSGALEEASAYQSRDYYN
FPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAAQCRYGDLASLHGGGAAGPGSG
SPSAAATSSWHTLFTAEEGQMYGPCGTGAGGSAGEAGSVAPYGYTRPPQGLAGQEGDFPP
PDVWYPGGVVSRVPYPSPSCVKSEMAPWMEGYSGPYGDMRLETTRDHVLPIDYYFPPQKT
CLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRK
CYEAGMTLGARKLKKLGNLKLQEEGEPSSTTSPTEEPTQKLTLSHIEGYECQPIFLNVLE
AIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQ
YSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQ
ITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQ
LTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHT
Q
NT seq 2706 nt   +upstreamnt  +downstreamnt
atggaggtgcagttaggactggggaggctctacccccggccgccgtccaagacctaccga
ggagctttccagaacctgttccagagcgtccgagaagtgatccagaccccggggcctcgg
caccccgagcccgcgagcgcagcacctcccggcgcccgtttgcagcagcagcagcagcag
cagcagcagcagccgcggcggcggcgggagagcagttccgggcggcagcagcagcagcag
ggcgacgatggctccccgcaaagccagggcagatgcccggcgggctacctggccctggag
caggaaccgcagcccgcccagcaccagtcggcccccgagggccacgcagacagcggctgc
cttccggagcccggagctgccgcaggcaaggggctgccgccgccgccgccagcacctccg
gacgaggatgactcagctgccccatccacgttgtccctgctgggccccactttcccgggg
ttaagcggctgctcggccaaccttaaggacatcctgagcgaggctggcagcatgcaactc
ctgcagccgccaccgcagccgccgcagccgccgcagcaggaggcgacatcggaaggcggc
agcggcgggagagcgcgggaggccgcgggggctcccacctcgtccaaggacagttaccta
gcgggcagctcgaccatctcggacagcgccaaggagctgtgcaaggcggtgtcggtgtcc
atgggcttgggtgtggagtcgttggagcacctggggcccggggagcagcttcgcggggac
tgcatgtacgccccgctcctgggcgggccgcccgccgtgcgccccgctgcttgcacccag
ctggccgaatgcaaaggctccctgctggatgagcgcccgagcaagggcgccgaagagact
tccgactacccgcctttcaaggcaggttacgccaaggcgctggacggcgacagcctgggc
tgccccggcggcggcgaagcggaggtctccgggccacttgagctgccatccagcctgtcc
ctctacaagtccggcgccctggaagaggcctcggcgtatcagagtcgcgactactacaac
tttccgctcgccctggccgggccgccgcccccgccgccgcctccccacccgcacgcccgc
atcaagctggagaacccgctggactacggcagcgcctgggcggccgcggccgcggcgcag
tgccgctacggggacctggcgagcctgcacggcgggggcgccgcgggacccggctcgggc
tcaccctccgccgccgccacctcctcctggcacactctcttcaccgccgaagagggccag
atgtacgggccctgtggcactggcgccggcggcagcgcgggcgaggcgggctctgtggcc
ccctacggctacacgcggccaccgcaggggctggcgggtcaggaaggcgactttcccccg
cccgatgtgtggtatcccggcggcgtggtgagcagagtgccctacccgagtcccagttgt
gtcaaaagcgagatggccccctggatggagggctactccgggccttacggagacatgcgg
ttggagaccaccagggaccatgttctgcccattgactactactttccaccgcagaagacg
tgcctgatctgtggggacgaagcctctggctgtcactatggagctctcacttgtggaagc
tgcaaagtcttctttaaaagagcggctgaaggaaaacagaagtacctgtgcgccagcagg
aatgattgcaccatcgataaattccgaaggaaaaattgtccatcttgtcgcctccggaaa
tgctacgaagcagggatgactctgggagcccggaagctgaagaaactcggcaatctgaag
ctgcaggaggaaggggagccttccagcaccacgagccccaccgaggagccaacccagaag
ctgacactgtcgcacattgaaggctatgagtgtcagcccatcttcctgaatgtcctggag
gccatcgagcccggcgtggtgtgtgccgggcatgacaacaaccagcccgactccttcgcg
gccctgctctccagcctcaacgaactgggcgaaaggcagctcgtgcacgtggtcaagtgg
gccaaggccctgcccggcttccgcaacttgcacgtggatgaccagatggcagtcattcag
tactcctggatgggcctgatggtgttcgccatgggctggcgctccttcaccaatgtcaac
tccaggatgctctactttgcccctgacctggttttcaatgagtaccgcatgcacaagtcc
cggatgtacagccagtgcgtccgaatgaggcacctctctcaagagttcgggtggctgcag
atcacgccacaggagttcctgtgcatgaaggcgctgctgctgttcagcatcattccagtg
gatgggctgaaaaaccagaagttctttgatgaacttcgaatgaactacatcaaggaactc
gaccgcatcatcgcgtgcaagagaaaaaaccccacgtcctgctcgaggcgcttctaccag
ctgaccaagctcctggactccgtgcagcctattgcacgagagctgcaccagttcaccttt
gacctgctgatcaagtcccacatggtgagcgtcgactttccggaaatgatggcagagatc
atctccgtgcaagtgcccaagatcctgtcgggcaaggtcaagcccatctatttccacacg
cagtga

DBGET integrated database retrieval system