KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517580
Entry
107517580         CDS       T06036                                 

Gene name
GIP
Definition
(RefSeq) gastric inhibitory polypeptide
  KO
K05258  gastric inhibitory polypeptide
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    107517580 (GIP)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107517580 (GIP)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107517580 (GIP)
SSDB
Motif
Pfam: Hormone_2
Other DBs
NCBI-GeneID: 107517580
NCBI-ProteinID: XP_016013922
LinkDB
Position
Unknown
AA seq 140 aa
MAMKTSLLLVSLLLAVVLGGKEEGHSRFHTKVSGSQPRSRRYAEGTFISDYSIAMDKIRQ
QDFVNWLLAQKGKKNDWKHNITQREAQALELAHQSNRKKEAREQQDSLPKNPSDEDLLKD
LLIREVLAWMVDQMELCRLR
NT seq 423 nt   +upstreamnt  +downstreamnt
atggccatgaagacctctctgctgctggtgtcgctgctcctcgcagtggtgctaggaggg
aaggaagagggtcactccagattccacactaaggtcagtggctcccaaccccgaagccgc
aggtatgccgaggggactttcatcagtgactacagtatcgccatggacaagatccgccaa
caagactttgtgaactggctgttggcacagaaggggaaaaagaatgactggaaacataac
atcacccagagggaggcccaggccctagagctggcccatcaatctaacaggaagaaggag
gccagggagcagcaggactctctacccaagaaccctagtgatgaagatctgctaaaggac
ttactgatcagagaggtgctggcctggatggtggaccagatggagctctgtagactcagg
tag

DBGET integrated database retrieval system