KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517617
Entry
107517617         CDS       T06036                                 

Gene name
SGCA
Definition
(RefSeq) alpha-sarcoglycan
  KO
K12565  alpha-sarcoglycan
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107517617 (SGCA)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107517617 (SGCA)
   05414 Dilated cardiomyopathy
    107517617 (SGCA)
   05416 Viral myocarditis
    107517617 (SGCA)
SSDB
Motif
Pfam: Sarcoglycan_2 CbtA
Other DBs
NCBI-GeneID: 107517617
NCBI-ProteinID: XP_016014032
LinkDB
Position
Unknown
AA seq 387 aa
MAAALIWIPLLAGLLAGLRGTKAQQTTLHPLVGRIFVHTLDHETFLHLPEHVAIPPAIPV
TYHAHLQGHPDLPRWLRYTQRSPHHPGFLYGTPTLEDRGRQVIEVTAYNRDSFDTTRQRL
VLLIGDPEGPLLPYQAEFLVRSHDVEEVLPSTPASRFLIALGGLWEPGAFQLLNITSALD
RGGRVPLPIEGRKEGVYIKVGSASPFSTCLKMVASPDSHARCAQGQPPLLSCYDTLAPHF
RVDWCNVSLVDKSVPEPADEVPTPGDGILEHDPFFCPPTEATARDFLTDALVTLLVPLLV
ALLLTLLLAYIMCCRREGRLKRDLATSDIQMVHHCTIRGNTEELRQMAASREVPRPLSTL
PMFNVRTGERLPPQVDSAQVPLILDQH
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcagccgcactgatctggattcctcttcttgccggcctcctggcagggctgcggggc
accaaggcccagcagaccactctgcaccccctcgtgggccgcatctttgtgcataccttg
gaccacgaaaccttcctgcatcttcctgagcacgttgctatcccacccgccatccctgtc
acctaccatgctcacctccagggacacccagacctgccgcggtggctacgctatacgcag
cggagcccccaccaccctggcttcctttatggtactcccaccctggaagatcgaggacgc
caggtcatcgaggtcacagcgtacaaccgggacagcttcgacaccacccggcagaggctg
gtgctgttgattggggacccagaaggacccctgctgccataccaggctgagttcctggtg
cgcagccatgatgtggaggaggtcctgccctcaacacctgccagccgcttcctcatagct
ttggggggcctctgggagcctggggcattccagcttctcaatatcacctctgccttggac
cgtgggggccgtgtccctcttcccatagaaggtcgcaaggaaggggtgtacatcaaagtg
ggctctgcctcacccttctccacctgcctgaagatggtggcatctcccgacagccatgct
cgctgtgcccagggccagcctccgcttctgtcctgctacgacaccttggcacctcacttc
cgcgttgactggtgcaatgtgtctctggtggataagtcggtaccagagcctgcagatgag
gtgcccactccaggcgatgggatcctggagcatgacccgttcttctgcccacccactgag
gccacagcccgagacttcctgactgatgcgctggtcaccctcctggtacctctcttggtg
gccctgttgctcaccctactgctggcctacatcatgtgctgccggcgggagggacggctg
aagagagatctggccacctctgacatccagatggtccaccattgcaccatccgcgggaat
acggaggagctgcgacagatggcagctagccgagaggtgcccaggccactctccaccctg
cccatgttcaatgtgcgcacaggcgagcggctgcctccccaggtggacagcgcccaggtg
cccctcatcctggaccagcactga

DBGET integrated database retrieval system