KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517650
Entry
107517650         CDS       T06036                                 

Gene name
ABCC4
Definition
(RefSeq) multidrug resistance-associated protein 4 isoform X1
  KO
K05673  ATP-binding cassette, subfamily C (CFTR/MRP), member 4
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01523  Antifolate resistance
ray02010  ABC transporters
ray04024  cAMP signaling pathway
ray04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    107517650 (ABCC4)
  09132 Signal transduction
   04024 cAMP signaling pathway
    107517650 (ABCC4)
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    107517650 (ABCC4)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01523 Antifolate resistance
    107517650 (ABCC4)
Transporters [BR:ray02000]
 ABC transporters, eukaryotic type
  ABCC (CFTR/MRP) subfamily
   ABCC1, 2, 3, 4, 5, 6, 10, 11, 12, 13 subgroups
    107517650 (ABCC4)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 MMR_HSR1 AAA_29 RsgA_GTPase AAA_21 Dynamin_N AAA_23 AAA_7 DUF87
Other DBs
NCBI-GeneID: 107517650
NCBI-ProteinID: XP_016014103
LinkDB
Position
Unknown
AA seq 1325 aa
MLPVYPEVKPNPLQSANLCSRVFFWWLNPLFKVGHKRRLEEDDMYSVLPEDRSKYLGEEL
QGFWDKEVLRAERDSRKPSLTKAIIKCYWKSYLVLGVFTLIEESLKVVQPIFLGKIIDYF
EKHDPTNSVTLHEAYGYATVLSVCTLVLAILHHLYFYHVQCAGMRLRVAMCHMIYRKALR
LSNVAMSKTTTGQIINLLSNDVNKFDQVTVFLHFLWAGPLQAIAVTALLWMEIGISCLAG
MAILIILLPLQSCIGKLFSSLRSKTAAFTDMRIRTMNEVITGIRIIKMYAWEKSFAELIT
NLRRKEISKVLRSSYLRGMNLASFFVGSKLIIFVTFTVYVLLGNVITASRVFVTVALYAT
VRLTVTLFFPSAIEKVSEAVVSIRRIKNFLLLDEIKERNSQLLSDGKTIVHVQDFTTFWD
KSLETPTLQGLSFTVRPGELLAVVGPVGAGKSSLLSAVLGELSPSQGLVSVHGRIAYVSQ
QPWVFSGTVRSNILFGKKYEKERYKKVIQACALKKDLELLEDGDLTMIGDRGTTLSGGQK
ARVNLARAVYQDADIYLLDDPLSAVDAEVGRHLFQLCICQTLHEKITILVTHQLQYLKAA
SQILILKDGKMVQKGTYTEFLKSGIDFGSLLKKENEEAEQSSIPGSPSLRSRSFSESSVW
SQQSSRPSLKDGAPEHEAIKNMQVTLTKESRSEGKVGIKAYKNYFTAGAHWLMLIFILLV
NITAQVTYIFQDWWLSYWANEQSALNITVNGKGNITEKLDLNWYLGIYSGLTIAVFIFGI
ARCLLVFYVLVNASKTLHDRMFESILKAPVLFFDRNPIGRILNRFSKDIGHMDDLLPLTF
IDFIQTFLLVIAVVGVAVSVIPWIVIPLVPLGIVFFVLRSYFLETSRDVKRLESTTRSPV
FSHLSSSLQGLWTIRAYKTEERFQELFDAHQDLHSEAWFLFLTTSRWFAVRLDAICAIFV
IITAFGSLILAKTLDAGQVGLALSYSLTLMGMFQWSVRQSAEVENMMISVERVIEYTDLE
KEEPWEYPKRPPPGWPHEGVIVFDNVNFTYSLDGPLVLKHLTALIKSREKVGIVGRTGAG
KSSLISALFRLSEPKGKIWIDKILTTEIGLHDLRKKMSIIPQEPVLFTGTMRKNLDPFNE
HTDEELWNALKEVQLKEAIEDLPGKMDTELAESGSNFSVGQRQLVCLARAILKKNQILII
DEATANVDPRTDELIQKKIREKFAQCTVLTIAHRLNTVIDSDKIMVLDSGRLKEYDEPYV
LLQNKDSLFYKMVQQLGKAEAAALTEIAKQVYFKRNYPDITQNGHVATSTSNGQPSALTI
FETAL
NT seq 3978 nt   +upstreamnt  +downstreamnt
atgctgccggtgtacccggaggtgaagcccaacccgctgcagagcgcgaacctctgctcg
cgcgtgttcttctggtggctaaaccccttgtttaaagttggtcacaaacggagattagaa
gaagatgatatgtattcggtgcttccagaagatcgctccaagtaccttggagaagagctg
caagggttctgggataaagaagtcttgagagcagagagagactcacggaagccttcttta
acaaaagcgatcataaagtgttactggaaatcctatttagttttgggagtttttacgtta
attgaggaaagcctcaaagtagtccagcccatatttttggggaaaattattgattatttt
gaaaaacacgatcccaccaattctgtgactttgcacgaggcctacggctatgccacggtt
ctgtctgtctgcacgctcgttttggccatactgcaccacctgtacttttatcacgttcag
tgtgctgggatgaggttaagagtagccatgtgccatatgatttatcggaaggcacttcgc
cttagtaacgtggccatgagcaagaccaccacaggccagattatcaatctgctgtccaat
gatgtgaacaagtttgatcaggtaacagtgttcttgcactttctgtgggcaggcccgctg
caggccatcgcagtaactgccctgctctggatggaaataggaatttcgtgcctcgccggg
atggcaattctaattattcttctgcctttgcaaagctgcattggaaagttgttttcatca
ctccggagtaagactgcagctttcacagacatgagaatcagaaccatgaatgaagttata
accggcataagaataataaaaatgtatgcttgggaaaagtcatttgcagaacttattacc
aatttgagaaggaaggaaatttccaaggttttgagaagttcctaccttagaggaatgaat
ttggcatcgttttttgttggaagcaaacttatcatttttgtgaccttcaccgtctacgtg
ctccttggcaacgtgatcacagccagccgcgtgttcgtgacagtggcactatatgcgact
gtgcggttgacggtcactctcttcttcccctcggccatcgagaaggtgtcagaggcagtt
gtcagcatccgaagaatcaagaactttctattgcttgatgagatcaaagagcgtaattct
caactgctgtcagacggtaaaactatagtgcatgtgcaagacttcactactttttgggat
aagagcttagaaaccccaactctgcaaggcctttcctttactgtcagacctggtgaattg
ttagctgtggttggaccggtgggagcaggaaagtcatcgctgttgagtgccgtgctgggg
gaactgtccccaagccaggggctagtcagtgtgcatggacgaatcgcgtatgtttctcag
cagccctgggtgttttcaggaactgtgaggagcaatattttatttgggaagaaatatgaa
aaggaacgatacaaaaaagtaatacaggcgtgtgccttgaaaaaggatttggagcttttg
gaggatggagatcttactatgataggagaccggggaaccacactaagtggagggcagaaa
gcccgggtcaacctcgcaagagcggtatatcaggatgcagacatctaccttctagacgat
cctctcagtgcagtggatgcagaagttggcaggcatctgttccaactgtgtatttgtcaa
accttgcatgagaagatcacaatcttagtgactcatcagttgcagtacctaaaagctgca
agtcagattctgatattgaaagatggtaaaatggtacaaaagggaacttacactgagttt
ctgaagtccgggatagattttgggtcccttttgaagaaagaaaatgaggaggctgaacaa
tcttccattccaggaagtccctcactgaggagtcggtccttctcggagtcttcagtttgg
tctcaacagtcttctagaccctcgttgaaagacggtgctccagagcacgaagctatcaag
aatatgcaggttacactaaccaaggagagccgttctgaaggaaaagttgggatcaaggcc
tacaagaattacttcacagccggtgcccactggttaatgctcattttcattcttctagta
aacatcacagctcaggtcacctacatttttcaagattggtggctttcatactgggcaaat
gaacagagcgccctgaacatcactgtaaatggaaaaggaaatataactgagaagcttgat
cttaactggtacttaggaatttattcaggtttaactatagctgtcttcattttcggcata
gcaagatgtttgttggtattctacgtccttgttaatgcttcaaaaactttacacgacaga
atgtttgaatccattttgaaagctccagtattgttctttgatagaaatccaataggaaga
attttaaatcgtttctccaaagacattggacacatggatgacttgctgcccctgacattt
atagatttcatccagacgtttctactagtgattgctgtggtaggcgtggcggtgtcggtg
attccttggattgtgatacctctggttcccctcggcatcgttttctttgttcttcgtagt
tatttcttagaaacgtcaagagatgtcaaacgcctggaatctacaacacggagcccagtg
ttttcccacctatcgtcttccctccagggactctggactatccgggcatacaaaactgaa
gagaggtttcaggaactgtttgacgcacaccaggatttgcattcagaggcctggttctta
tttctgactacgtcccgatggtttgccgtgcgtctggatgccatctgtgccatctttgtc
attattactgcctttgggtcgctgattctggcaaaaactttggatgctgggcaggttggc
ctggcattgtcctactccctcacgctcatggggatgttccagtggagcgtcaggcaaagc
gctgaagttgaaaatatgatgatttcagtagaaagggtgatagaatatacagaccttgag
aaagaagagccttgggaatacccaaaacgcccaccgccaggctggccccatgaaggagtg
atagtctttgacaatgtgaacttcacatacagtttagatgggcctctggtattgaaacac
ctgacagcactcattaaatcaagagaaaaggttggcattgtgggaagaacaggagctggg
aaaagttccctcatctcagccctttttagattgtcggaacccaaaggtaaaatttggatt
gataagatcttgacaacagaaattggacttcatgatttaagaaagaaaatgtcaatcata
cctcaggaacctgttttattcactggaacaatgaggaaaaatctggatccttttaatgag
catacggatgaggaactgtggaatgccttaaaagaggtacaactcaaagaagccatcgaa
gatcttcctggtaaaatggatactgaattagcagaatctggatcgaacttcagtgttgga
cagagacagctggtgtgccttgccagggctattctgaagaaaaatcagatattgataatt
gatgaagcgacagcaaatgtggatccaagaactgatgagttaatacaaaagaaaattcgg
gagaaatttgcccagtgcactgtactcaccattgcacacaggttgaacaccgttattgat
agtgacaagattatggttttggattcaggaagactgaaagaatatgatgagccatatgtt
ttgctgcaaaataaagatagcctattttacaagatggtgcaacaactgggtaaggcagaa
gctgctgccctcactgaaatagcaaaacaggtgtacttcaaaaggaattatccagatatt
actcagaatggccacgtggctacaagcacttccaatggacagccctcagccttaactatt
tttgagactgcactgtga

DBGET integrated database retrieval system