KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517741
Entry
107517741         CDS       T06036                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X1
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04012  ErbB signaling pathway
ray04062  Chemokine signaling pathway
ray04110  Cell cycle
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04310  Wnt signaling pathway
ray04340  Hedgehog signaling pathway
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04510  Focal adhesion
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04657  IL-17 signaling pathway
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04722  Neurotrophin signaling pathway
ray04728  Dopaminergic synapse
ray04910  Insulin signaling pathway
ray04916  Melanogenesis
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04934  Cushing syndrome
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05135  Yersinia infection
ray05160  Hepatitis C
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05213  Endometrial cancer
ray05215  Prostate cancer
ray05217  Basal cell carcinoma
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    107517741 (GSK3B)
   04310 Wnt signaling pathway
    107517741 (GSK3B)
   04340 Hedgehog signaling pathway
    107517741 (GSK3B)
   04390 Hippo signaling pathway
    107517741 (GSK3B)
   04151 PI3K-Akt signaling pathway
    107517741 (GSK3B)
   04150 mTOR signaling pathway
    107517741 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107517741 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107517741 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    107517741 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107517741 (GSK3B)
   04657 IL-17 signaling pathway
    107517741 (GSK3B)
   04662 B cell receptor signaling pathway
    107517741 (GSK3B)
   04062 Chemokine signaling pathway
    107517741 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107517741 (GSK3B)
   04917 Prolactin signaling pathway
    107517741 (GSK3B)
   04935 Growth hormone synthesis, secretion and action
    107517741 (GSK3B)
   04919 Thyroid hormone signaling pathway
    107517741 (GSK3B)
   04916 Melanogenesis
    107517741 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    107517741 (GSK3B)
   04722 Neurotrophin signaling pathway
    107517741 (GSK3B)
  09158 Development and regeneration
   04360 Axon guidance
    107517741 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517741 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107517741 (GSK3B)
   05225 Hepatocellular carcinoma
    107517741 (GSK3B)
   05226 Gastric cancer
    107517741 (GSK3B)
   05217 Basal cell carcinoma
    107517741 (GSK3B)
   05215 Prostate cancer
    107517741 (GSK3B)
   05213 Endometrial cancer
    107517741 (GSK3B)
   05224 Breast cancer
    107517741 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107517741 (GSK3B)
   05020 Prion disease
    107517741 (GSK3B)
   05022 Pathways of neurodegeneration - multiple diseases
    107517741 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107517741 (GSK3B)
   04931 Insulin resistance
    107517741 (GSK3B)
   04934 Cushing syndrome
    107517741 (GSK3B)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    107517741 (GSK3B)
  09172 Infectious disease: viral
   05160 Hepatitis C
    107517741 (GSK3B)
   05162 Measles
    107517741 (GSK3B)
   05163 Human cytomegalovirus infection
    107517741 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107517741 (GSK3B)
   05165 Human papillomavirus infection
    107517741 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107517741 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107517741 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107517741 (GSK3B)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     107517741 (GSK3B)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   107517741 (GSK3B)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    107517741 (GSK3B)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like APH Kdo ABC1
Other DBs
NCBI-GeneID: 107517741
NCBI-ProteinID: XP_016014289
LinkDB
Position
Unknown
AA seq 450 aa
MSGRPRTTSFAESCKPVQQPSAFGSMKVSSALDKKNKTRCPVTKFAGDKDGSKVTTVVAT
PGQGPDRPQEVSYTDTKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRK
LDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMY
QLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYR
APELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIRE
MNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLT
PLEACAHSFFDELRDPNIKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAAST
PTNATAASDANAGDRGQTNNAASASASNST
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagtgcattggataaaaagaacaagacacggtgt
cctgtcactaagtttgcaggagacaaggatggcagtaaggtgactacagtggtggcaact
cctgggcagggcccagacaggccacaagaagtcagctatacagacactaaagtaattgga
aatgggtcatttggtgtggtatatcaagcaaaactttgtgattcaggagaactggttgcc
atcaagaaagtattacaggacaagagatttaagaaccgagagctccaaatcatgagaaag
ctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggtgagaagaaa
gatgaggtctatcttaatctggtgctggattatgtcccggaaacagtatacagagttgcc
agacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttgtatatgtat
cagctgttccgaagtttagcctatattcattcctttggaatctgccatcgggatattaaa
ccacagaacctcttgttggaccccgatacagccgtcttaaaactttgtgactttggaagt
gcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcggtactatagg
gcaccagagttgatctttggagccactgattatacctctagtatagatgtatggtctgcg
ggctgtgtgctggccgagctgttattaggacaaccaatatttccaggggacagtggtgtg
gatcagttggtggaaataatcaaggtcctggggacaccaacaagggagcaaattagagaa
atgaacccaaactatacagaattcaaatttcctcaaattaaggcacatccttggactaag
gattcgtcaggaacaggacatttcacctcaggagtccgggtcttccgaccccgaactcca
ccagaggcaattgcactgtgtagccgtctgctggagtatacaccaactgccagactgaca
ccactggaagcttgtgcacattcattttttgatgaattacgggacccaaatatcaaacta
ccaaatgggcgagacacacccgcactcttcaacttcaccactcaagaattgtcaagtaat
ccacctctagctactattcttattcctcctcatgctcggattcaagcagctgcttcaact
cctacaaatgccacagcagcctcagatgctaatgctggagaccgtggacagaccaataac
gctgcttctgcatcagcttccaactccacctga

DBGET integrated database retrieval system