KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517751
Entry
107517751         CDS       T06036                                 

Gene name
AVPR2
Definition
(RefSeq) vasopressin V2 receptor
  KO
K04228  arginine vasopressin receptor 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04072  Phospholipase D signaling pathway
ray04080  Neuroactive ligand-receptor interaction
ray04962  Vasopressin-regulated water reabsorption
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    107517751 (AVPR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107517751 (AVPR2)
 09150 Organismal Systems
  09155 Excretory system
   04962 Vasopressin-regulated water reabsorption
    107517751 (AVPR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:ray04030]
    107517751 (AVPR2)
G protein-coupled receptors [BR:ray04030]
 Rhodopsin family
  Peptide
   Vasopressin
    107517751 (AVPR2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 Git3 7TM_GPCR_Srv
Other DBs
NCBI-GeneID: 107517751
NCBI-ProteinID: XP_016014325
LinkDB
Position
Unknown
AA seq 373 aa
MAFTTSAVPWLLSQPFPVGNSTEEEPVDPRDPLLARAELALLSTVFVAVTLSNGLVLAAL
VRRGRRGRWAPMHVFIGHLCLADLAVALFQVLPQLAWDATDRFHGPDALCRAVKYLQMVG
MYASSYMILAMTLDRHRAICRPMLAYRHGGGAHWNRPVLVAWAFSLLLSLPQLFIFAQRD
VGDGSGVIDCWARFAEPWGLRAYVTWIALMVFVAPALGIAACQVLIFREIHTSLLPGPVE
RAGGHRGGRRGGRQTGSSGEGARVSAAMAKTVRMTLVIVIVYVLCWAPFFLVQLWAAWDP
EAPREGPPFVLLMLLASLNSCTNPWIYASFSSSVSSELRSLLCFPWRRTPPSLGPQEESC
ATASSFLAKDTSS
NT seq 1122 nt   +upstreamnt  +downstreamnt
atggctttcaccacctccgctgtgccctggctcctctctcagcctttcccagttggcaac
agcaccgaggaggagcccgtggatccccgggacccgctgctagcccgggcggagctggcc
ctgctctccacggtctttgtggctgtgaccctgagcaatggcttggtgctggccgcccta
gtgcggcggggccggcggggccgctgggctcctatgcacgtcttcatcggccacttgtgc
ctggctgacctggctgtggccctgttccaagtgctaccccaactggcctgggatgccacc
gaccgcttccatgggcccgatgccctgtgccgggccgtcaagtatctgcagatggtgggc
atgtatgcctcctcctacatgatcctggccatgactttggaccgccaccgcgccatctgc
cgccccatgttggcataccgccacggaggtggagctcactggaaccggccagtgctggtg
gcctgggccttctcgctccttctcagcctgccccagctgttcatctttgcccagcgcgat
gtgggagatggcagcggggtcattgactgctgggcccgctttgccgaaccctggggactc
cgtgcctacgtcacctggatcgccctaatggtgtttgtggcacctgccctgggcatcgct
gcctgtcaggtgctcatcttccgggagattcataccagcctattgccggggccagtagag
agggctgggggccaccgaggggggcgccgaggagggcgccagacaggcagttccggcgag
ggagctcgggtgtcagcagccatggccaaaaccgtgaggatgacgttggtgattgtgatt
gtctacgtgctgtgctgggcgcccttctttcttgtgcagctgtgggcagcgtgggaccca
gaggcgcctcgggaagggccgcccttcgtgctgctcatgctgctggccagcctcaacagc
tgtaccaacccctggatctacgcctccttcagcagcagcgtctcctcggagttgcgcagc
ctcttgtgcttcccttggaggcgcaccccacccagcctggggccccaagaggagtcctgc
gccactgcgagctccttcctggccaaggacacttcctcctga

DBGET integrated database retrieval system