KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517839
Entry
107517839         CDS       T06036                                 

Gene name
EBAG9
Definition
(RefSeq) receptor-binding cancer antigen expressed on SiSo cells
  KO
K22455  estrogen receptor-binding fragment-associated gene 9 protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04915  Estrogen signaling pathway
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107517839 (EBAG9)
SSDB
Other DBs
NCBI-GeneID: 107517839
NCBI-ProteinID: XP_016014472
LinkDB
Position
Unknown
AA seq 213 aa
MAITQFRLFKVCTCLATVFSFLKRLICRSGRGRKLSGDQITLPTTVDYSSVPKQTDVEEW
TSWDEDAPTSVKIEGGNGNVATQQNALEQLEPDYFKDMTPTIRKTQKIIIKKREPLNYGI
PDGSTGFSSRLAATQDMPFIHQSPELGDLDTWQENTNAWEEEEDAAWQAEEVLRQQKLAD
REKRAAEQQRKKMEKEAQRLMKKEQNKIGVKLS
NT seq 642 nt   +upstreamnt  +downstreamnt
atggctatcacacagtttcggttatttaaagtttgtacctgcttagcaacagtattctca
ttccttaagagattaatatgcagatctggcagaggacggaaattaagtggagaccaaata
actttgccaactacagttgattattcatcagttccaaaacagacagatgttgaagagtgg
acttcctgggatgaagatgcacccacaagtgtaaagatcgaaggagggaatgggaatgtg
gcaacacaacaaaatgctttggaacaactggaacccgactattttaaggacatgacacca
actataaggaaaactcagaaaatcattattaagaagagagagccattaaattatggcatt
ccagatggtagcacaggtttctctagtaggttagcagctacacaggatatgcctttcatc
catcagtcgcctgagttgggtgacttagatacctggcaggaaaataccaatgcatgggaa
gaagaagaagacgcggcctggcaagcagaagaagttctgaggcagcagaagctagcggac
agagaaaagagagctgcagaacaacaaagaaagaaaatggaaaaggaagcacagcggcta
atgaagaaagaacaaaacaaaattggtgtgaaactttcataa

DBGET integrated database retrieval system