KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517865
Entry
107517865         CDS       T06036                                 

Gene name
SLC12A2
Definition
(RefSeq) solute carrier family 12 member 2 isoform X1
  KO
K10951  solute carrier family 12 (sodium/potassium/chloride transporter), member 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
ray04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107517865 (SLC12A2)
   04972 Pancreatic secretion
    107517865 (SLC12A2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107517865 (SLC12A2)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107517865 (SLC12A2)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107517865 (SLC12A2)
Transporters [BR:ray02000]
 Solute carrier family (SLC)
  SLC12: Electroneutral cation-coupled Cl cotransporter
   107517865 (SLC12A2)
SSDB
Motif
Pfam: SLC12 AA_permease AA_permease_N AA_permease_2 YqgB
Other DBs
NCBI-GeneID: 107517865
NCBI-ProteinID: XP_016014503
LinkDB
Position
Unknown
AA seq 1204 aa
MEPGPTAPSSGSPRLAGVGETPPAAALAAAGVDLPGTAVSSVPEDAAAASQGGGGVRGEG
AAAAGDGLGRPLGPTPSQSRFQVDLVSENAGRAAAAAAAAGVEAGRKETPADGKASGESG
PAKGSEEAKGRFRVNFVDPAASSSADDSLSDAAGVGGDGPNVSFQNGGDTVLSEGSSLHS
GGGGGSGHHQHYYYDTHTNTYYLRTFGHNTMDAVPRIDHYRHTAAQLGEKLLRPSLAELH
DELEKEPFEDGFANGEESTPTRDAVVTYTAESKGVVKFGWIKGVLVRCMLNIWGVMLFIR
LSWIVGQAGIGLSVLVIVMATVVTTITGLSTSAIATNGFVRGGGAYYLISRSLGPEFGGA
IGLIFAFANAVAVAMYVVGFAETVVELLKEHSILMIDEINDIRIIGAITVVILLGISVAG
MEWEAKAQIVLLVILLLAIADFVIGTFIPLESKKPKGFFSYKSEIFNENFGPDFREEETF
FSVFAIFFPAATGILAGANISGDLADPQSAIPKGTLLAILITTVVYIGIAVSVGSCVVRD
ATGNINDTIVTELTNCTSAACKLNFDFSYCESNPCSYGLMNNFQVMSMVSGFAPLISAGI
FSATLSSALASLVSAPKIFQALCKDNIYPAFQMFAKGYGKNNEPLRGYILTFLIALGFIL
IAELNVIAPIISNFFLASYALINFSVFHASLAKSPGDFIGFYLSIWISLIGAILCCIVMF
VINWWAALLTYVIVLGLYIYVTYKKPDVNWGSSTQALTYLNALQHSIRLSGVEDHVKNFR
PQCLVMTGAPNSRPALLHLVHDFTKNVGLMICGHVHMGPRRQAMKEMSIDQAKYQRWLIK
NKMKAFYAPVHADDLREGAQYLMQAAGLGRMKPNTLVLGFKKDWLQADMREVDMYINLFH
DAFDIQYGVVVIRLKEGLDISHLQGQEELLSSQEKSPGVKDVVLSMEYSKKSDLDTSKPS
GEKTVTHKDEEEDGKTPTQPLLKKESKGPAVPLNVADQKLLEASTQFQKKQGKNTIDVWW
LFDDGGLTLLIPYLLTTKKKWKDCKIRVFIGGKINRIDHDRRAMATLLSKFRIDFSDIMV
LGDINTKPKKENIVAFDEMIEPYRLHEDDKEQDIADKMKEDEPWRITDNELELYKTKTYR
QIRLNELLKEHSSTANIIVMSLPVARKGAVSSALYMAWLEALSKDLPPILLVRGNHQSVL
TFYS
NT seq 3615 nt   +upstreamnt  +downstreamnt
atggagccggggcctacggcgccctcctccggctccccaaggctggccggggtcggggaa
acgccgccagccgccgcgctggccgccgccggggtggacctgccaggcacggcggtgtcc
tcggtgccggaggatgctgcagccgctagccagggcggcggcggggtccgcggtgagggc
gccgcggcagcaggggacgggctgggcagacccctggggcccaccccgagccaaagccgc
ttccaggtggatctagtttctgagaacgcggggcgggctgctgcggcggcggcggcggcg
ggtgttgaggcggggaggaaggagacccctgcggatgggaaagccagcggcgagagcggg
ccggcgaaaggcagcgaggaagccaagggccgcttccgtgtgaacttcgtggaccccgct
gcctcctcgtctgcggacgacagcctgtcggatgcggcgggagtcggaggtgacgggccc
aatgtgagcttccagaacggcggggacacagtgctgagcgagggcagcagcttgcactcg
ggcggcggcggcggcagtgggcaccaccaacattactactatgacacccacaccaacacc
tactacctgcgcaccttcggccacaacaccatggacgccgtgcccaggattgaccactat
cgacacacagcagcacagctgggcgagaagttgctccggcccagcctagcggagctccac
gatgagctggaaaaggaacctttcgaggatgggtttgcaaatggagaagaaagtactcct
accagagatgctgtggtcacgtatactgcggaaagtaaaggagttgtgaagtttggctgg
atcaagggtgtattagtacgttgtatgttaaacatttggggtgtgatgctcttcattaga
ctgtcatggatcgtaggtcaagctggaataggtctgtcggttctcgtaatagtaatggcc
actgtcgtgacaactatcacaggattgtctacgtcagcaatagctaccaatggatttgtc
cgaggaggaggagcatattatttaatatctagaagtctagggccagaatttggcggtgca
attggcctcattttcgcttttgccaatgctgttgcagttgctatgtatgtggttggattt
gcagaaactgtggtggagttgcttaaggaacattccatacttatgatagatgaaatcaat
gatattagaattattggagccattacagtggtgatccttttaggtatctcagtagctgga
atggagtgggaagcaaaagctcagattgttcttttggtgattctactacttgctattgct
gatttcgtcataggaacatttatcccattggagagcaagaagcccaaaggtttctttagt
tacaaatctgaaatatttaatgagaacttcggaccagattttcgagaggaagagactttt
ttttctgtatttgccatcttttttccggctgcaactggtattttggctggagcaaatatc
tcaggtgatctcgcagatcctcagtcagccatacctaaagggacactcttagccatttta
attactacggtggtttacataggaattgcagtatctgtaggttcttgtgttgttcgggat
gccacggggaacattaatgacactattgtaacagagctaacgaactgtacttctgcagcc
tgcaaattaaactttgacttttcttattgtgaaagcaatccttgttcctatggcctaatg
aacaacttccaggtaatgagcatggtgtcgggatttgcaccattaatttctgcaggtatc
ttttcagctacgctttcttctgcattagcatcccttgtgagtgctcccaaaatatttcag
gctttgtgtaaggacaacatctacccagcttttcagatgtttgctaaaggttatgggaaa
aataatgaacctcttcgcggctacatcttaacattcttaattgcacttggattcatctta
attgctgaactgaatgttattgctccaatcatctctaacttcttccttgcatcctatgca
ttgatcaatttttcagtattccatgcatcacttgcaaaatctccaggtgattttattggc
ttttatttatctatttggatatcacttattggagcaattctttgttgcatagtgatgttt
gtcattaactggtgggctgcgttgctaacatatgtgatagtccttgggctgtatatttat
gttacctacaaaaaaccagatgtgaactggggatcgtctacacaagccttgacttacctg
aatgcactgcagcattcgattcgtctttctggagtagaagaccatgtgaaaaacttcagg
ccacagtgtcttgttatgacaggtgctccaaactcacgtccagctttacttcatcttgtt
catgattttacaaaaaatgttggcttaatgatctgtggtcatgtacatatgggccctcga
agacaagccatgaaagagatgtccattgatcaagctaaatatcagcgatggcttattaaa
aacaaaatgaaagctttttatgctccagtacatgcagatgacttgagagaaggtgcacag
tatttgatgcaggctgctggtcttgggcgtatgaaaccaaacacacttgtccttggattt
aagaaggattggttgcaagcagatatgagggaagtggatatgtatataaacttattccat
gatgcctttgacatacaatatggagtagtggttatccgcctaaaagagggtctggatata
tctcatcttcaaggacaagaagaattattgtcatcacaagagaaatctcctggtgtcaag
gatgtggtactaagtatggaatatagtaagaaatcggatttagatacttccaaaccatct
ggtgaaaaaactgttacgcataaagatgaggaagaggatggcaagactccaactcaacca
ctgttgaaaaaagaatccaaaggccctgctgtgcctttaaatgtagctgaccaaaagctt
cttgaagctagtacacagtttcagaaaaagcaaggaaagaataccattgatgtctggtgg
ctttttgatgatggaggtttgactttattgataccttatcttctgactaccaagaaaaag
tggaaagattgtaagatcagagtattcattggtggaaaaataaacagaatagaccatgac
cggagagcgatggctactttacttagcaagttccggatagacttctccgatatcatggtc
ctaggagatattaatactaaaccaaagaaagaaaatattgtagcttttgatgaaatgatt
gagccataccgacttcatgaagatgataaagaacaagatatagcagataaaatgaaagaa
gatgagccatggagaataacagataatgaacttgaactttataaaaccaagacataccgg
cagatcaggttaaatgagttattaaaagaacattcaagcacagctaatatcattgtcatg
agtctcccagttgcacgaaaaggtgctgtgtctagtgctctctacatggcatggttagaa
gctctatctaaggacctaccacctatcctcctggttcgtgggaatcatcagagtgtcctt
accttctattcctaa

DBGET integrated database retrieval system