KEGG   Rousettus aegyptiacus (Egyptian rousette): 107517940
Entry
107517940         CDS       T06036                                 

Gene name
JAK1
Definition
(RefSeq) tyrosine-protein kinase JAK1
  KO
K11217  Janus kinase 1 [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04151  PI3K-Akt signaling pathway
ray04217  Necroptosis
ray04380  Osteoclast differentiation
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04621  NOD-like receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05203  Viral carcinogenesis
ray05212  Pancreatic cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107517940 (JAK1)
   04151 PI3K-Akt signaling pathway
    107517940 (JAK1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107517940 (JAK1)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107517940 (JAK1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    107517940 (JAK1)
   04658 Th1 and Th2 cell differentiation
    107517940 (JAK1)
   04659 Th17 cell differentiation
    107517940 (JAK1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107517940 (JAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107517940 (JAK1)
   05203 Viral carcinogenesis
    107517940 (JAK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107517940 (JAK1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107517940 (JAK1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107517940 (JAK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107517940 (JAK1)
   05161 Hepatitis B
    107517940 (JAK1)
   05160 Hepatitis C
    107517940 (JAK1)
   05171 Coronavirus disease - COVID-19
    107517940 (JAK1)
   05164 Influenza A
    107517940 (JAK1)
   05162 Measles
    107517940 (JAK1)
   05168 Herpes simplex virus 1 infection
    107517940 (JAK1)
   05163 Human cytomegalovirus infection
    107517940 (JAK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107517940 (JAK1)
   05169 Epstein-Barr virus infection
    107517940 (JAK1)
   05165 Human papillomavirus infection
    107517940 (JAK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107517940 (JAK1)
   05140 Leishmaniasis
    107517940 (JAK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107517940 (JAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107517940 (JAK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107517940 (JAK1)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  JAK family [OT]
   107517940 (JAK1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase FERM_F2 Jak1_Phl FERM_F1 RIO1 SH2
Other DBs
NCBI-GeneID: 107517940
NCBI-ProteinID: XP_016014614
LinkDB
Position
Unknown
AA seq 1156 aa
MQYLNIKEDCNAMAFCAKMRSSKKTEVNLEAPEPGVEVLFYLSDREPLRLGSGEYTAEEL
CIRAAQECCISPLCHNLFALYDENTKLWYAPNRTITVDDKTSLRLHYRMRFYFTNWHGTN
DNEQSVWRHSPKKQKNGYEKKKVPDATPLLDASSLEYLFAQGQYDLVKCLAPIRDPKTEQ
DGHDIENECLGMAVLAISHYAMIKKMQLPELPKDISYKRYIPETLNKSIRQRNLLTRMRI
NNVFKDFLKEFNNKTICDSSVSTHDLKVKYLATLETLTKHYGAEIFETSRLLISSENELN
WFHPNDSGNVLYYEVMVTGNLGIQWRQKPNVVPVEKEKNKLKRKKLENKQKKDEEKNKIR
EEWSNFSYFPEITHIVIKESMVSINKQDNKKMELKLSSHEEALSFVSLVDGYFRLTADAH
HYLCTDVAPPLIVHNIQNGCHGPICTEYAINKLRQEGSEEGMYVLRWSCTDFDNILMTVT
CFEKAEVLGGQKQFKNFQIEVQKGRYSLHGSDRSFPSLGDLMSHLKKQILRTDNISFVLK
RCCQPKPREISNLLVATKKAQEWQPVYPMSQLSFDRILKKDIMQGEHLGRGTRTHIYSGT
LVDYKEDEGISEEKRIKVILKVLDPSHRDISLAFFEAASMMRQVSHKHIVYLYGVCVRDV
ENIMVEEFVEGGPLDLFMHRKSDVLTTPWKLKVAKQLASALSYLEDKDLVHGNVCTKNLL
LAREGIDSECGPFIKLSDPGIPITVLTRQECIERIPWIAPECVEDSKNLSVAADKWSFGT
TLWEICYNGEIPLKDKTLIEKERFYESRCRPVTPSCKELADLMTRCMNYDPNQRPFFRAI
MRDINKLEEQNPDIVSEKKPATEVDPTHFEKRFLKRIRDLGEGHFGKVELCRYDPEGDNT
GEQVAVKSLKPESGGNHIADLKKEIEILRNLYHENIVKYKGICTEDGGNGIKLIMEFLPS
GSLKEYLPKNKNKINLTQQLKYAVQICKGMDYLGSRQYVHRDLAARNVLVESEHQVKIGD
FGLTKAIETDKEYYTVKDDRDSPVFWYAPECLIQCKFYIASDVWSFGVTLHELLTYCDSD
SSPMALFLKMIGPTHGQMTVTRLVNTLKEGKRLPCPHNCPDEIYHLMRKCWEFHPSNRTT
FQNLIEGFEALLKLGA
NT seq 3471 nt   +upstreamnt  +downstreamnt
atgcagtatctaaatataaaagaggactgcaatgccatggctttctgtgctaaaatgcgg
agctccaagaagaccgaggtgaatctggaagcccctgagccaggggtggaagtgctcttc
tatctgtcggatagggagcccctccggctgggcagtggcgagtataccgcagaggagcta
tgcatccgggcggcacaagaatgctgtatctctcctctgtgtcacaacctttttgctctg
tatgatgagaacaccaagctctggtatgccccaaatcgcaccatcactgttgatgacaag
acatcgcttcggctccactatcggatgaggttctattttaccaactggcatgggaccaat
gataatgagcagtcagtatggcgacattctccgaagaagcagaaaaatggctatgagaaa
aaaaaagttccagatgcaactcctctccttgatgccagctccctggaatatctgtttgct
cagggacagtatgacttggtcaaatgcctggctccaattcgagaccccaagactgagcag
gatgggcacgacatagagaacgagtgtctggggatggccgtcctggccatctcccattat
gccatgataaagaagatgcagttgccagaactccccaaggacatcagctacaagcgatat
attccagaaacattgaataagtccatcagacagaggaaccttctcaccaggatgaggata
aataatgtcttcaaggatttcctcaaggaatttaacaacaagaccatttgtgacagcagc
gtgtccacacatgacctgaaggtgaaatacctggctaccttggaaactttgacaaaacat
tatggtgctgaaatatttgagacttccaggttactgatttcatcagaaaatgagctgaat
tggtttcatccaaatgacagtggaaatgttctctactatgaagtgatggtgactggaaat
cttggaatccaatggaggcagaaaccaaatgtcgttcctgtcgaaaaggaaaaaaataaa
ctgaaacggaaaaaactggaaaataaacagaagaaggatgaggagaaaaacaaaatccgg
gaagagtggagcaatttttcttacttccctgaaatcactcatattgtaataaaggaatct
atggtcagcattaataagcaggacaacaaaaaaatggaactgaagctctcttcccacgag
gaggccttgtcttttgtgtccctggtagatggctactttcggctcacagcagacgcccat
cattacctttgcaccgacgtggctcccccactgatcgtccacaacatacagaatggctgt
catggtccaatctgcacagaatatgccatcaataaattgcggcaagaaggaagcgaggag
gggatgtacgtgctgcggtggagctgcaccgacttcgacaacatcctcatgaccgtcacc
tgctttgaaaaggctgaggtgctgggtggccagaaacagttcaagaactttcagatcgag
gtgcagaagggtcgctacagtctgcacggttcggaccgcagcttccccagcctgggagac
ctcatgagccatctcaagaagcagatcctccgcacagacaacatcagcttcgtgttgaag
cgctgctgccagcccaagccccgagaaatctccaatctgctggtggcaactaagaaagcc
caggagtggcagcccgtctaccccatgagccagctgagtttcgatcggatcctcaagaaa
gacattatgcaaggtgaacaccttgggagaggcacgcggacacacatctactctgggacc
ctggtggattacaaggaggacgaaggaatatctgaagagaagagaataaaagtgatcctc
aaagtcttggaccccagccacagggacatttctctggcattcttcgaggcagccagcatg
atgaggcaggtctcccacaaacacatcgtatacctctatggcgtctgtgtccgagacgtg
gagaatatcatggtggaagagtttgtggagggagggcccctggatctcttcatgcaccgg
aaaagtgatgtcctcaccacaccatggaagctcaaagtcgctaaacagctggccagcgcc
ttgagttacttggaggataaagacctggtccacggaaacgtgtgcacgaaaaacctcctc
ctggctcgtgagggcattgacagtgagtgcggcccattcatcaagctcagtgaccccggc
atccccatcacggtgctgaccaggcaagagtgcatagaacgcatcccgtggattgctcct
gagtgtgtcgaagactccaagaacctgagcgtggccgctgacaagtggagcttcggaacc
acactctgggaaatctgctacaacggtgagatccccctgaaagacaagacgctgatcgag
aaagaaagattctatgaaagccggtgcaggccagtgacgccatcttgtaaggagctggca
gaccttatgactcgctgcatgaactatgaccctaaccagagaccctttttccgagccatc
atgagagacatcaataagctggaagagcagaatccagacattgtttcagaaaaaaagcca
gcaactgaagtggaccccacacattttgaaaagcggttcttgaagaggatccgtgacttg
ggagagggccactttgggaaagttgagctctgcaggtatgaccctgaaggggacaataca
ggagagcaggtggctgtcaaatccctgaagcctgagagtggaggtaaccacatagctgat
ctgaagaaggaaattgaaatcttaaggaacctctatcatgagaacattgtgaagtacaaa
ggcatctgcacagaagatggaggaaatggtattaagctcatcatggaatttctgccttca
ggaagcttgaaggaatatcttccaaagaataagaacaaaattaacctcacccagcagtta
aaatatgccgttcagatttgtaaggggatggactatttgggttcacgacaatacgttcac
cgagacttagcagcaagaaatgtcctcgttgagagtgaacaccaagtgaaaattggagac
tttgggttaaccaaagcaatcgaaaccgataaggagtactacacagtcaaggatgatcgg
gacagccctgtgttttggtacgctccagaatgtttaattcagtgtaaattttatatcgcc
tctgacgtctggtctttcggagtgactctgcacgagctgcttacttactgtgattcagat
tccagtcccatggcattgttcctgaaaatgataggccctactcatggccagatgacagta
acaagacttgtgaatacattaaaagaaggaaaacgtttgccttgtccacataactgtcca
gatgagatttatcaccttatgagaaaatgctgggaattccacccatctaatcggacaacc
tttcagaaccttatcgaaggatttgaagcacttttaaaattaggagcatga

DBGET integrated database retrieval system