KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518064
Entry
107518064         CDS       T06036                                 

Gene name
KCNMA1
Definition
(RefSeq) calcium-activated potassium channel subunit alpha-1 isoform X1
  KO
K04936  potassium large conductance calcium-activated channel subfamily M alpha member 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04022  cGMP-PKG signaling pathway
ray04270  Vascular smooth muscle contraction
ray04911  Insulin secretion
ray04924  Renin secretion
ray04970  Salivary secretion
ray04972  Pancreatic secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    107518064 (KCNMA1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107518064 (KCNMA1)
   04924 Renin secretion
    107518064 (KCNMA1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107518064 (KCNMA1)
  09154 Digestive system
   04970 Salivary secretion
    107518064 (KCNMA1)
   04972 Pancreatic secretion
    107518064 (KCNMA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107518064 (KCNMA1)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Potassium channel, calcium- and sodium-activated (KCa/KNa)
   107518064 (KCNMA1)
SSDB
Motif
Pfam: BK_channel_a Ion_trans Ion_trans_2 TrkA_N
Other DBs
NCBI-GeneID: 107518064
NCBI-ProteinID: XP_016014892
LinkDB
Position
Unknown
AA seq 1263 aa
MANGGGGGGSSGGGGGGGGGSSLRMSSNIHANHLSLDASSSSSSSSSSSSSVHEPKMDAL
IIPVTMEVPCDSRGQRMWWAFLASSMVTFFGGLFIILLWRTLKYLWTVCCHCGGKTKEAQ
KINNGSSQADGTLKPVDEKEEAVAAEVGWMTSVKDWAGVMISAQTLTGRVLVVLVFALSI
GALVIYFIDSSKSRSADSLIPIESCQNFYKDFTLQIDMAFNVFFLLYFGLRFIAANDKLW
FWLEVNSVVDFFTVPPVFVSVYLNRSWLGLRFLRALRLIQFSEILQFLNILKTSNSIKLV
NLLSIFISTWLTAAGFIHLVENSGDPWENFQNNQALTYWECVYLLMVTMSTVGYGDVYAK
TTLGRLFMVFFILGGLAMFASYVPEIIELIGNRKKYGGSYSAVSGRKHIVVCGHITLESV
SNFLKDFLHKDRDDVNVEIVFLHNISPNLELEALFKRHFTQVEFYQGSVLNPHDLARVKI
ESADACLILANKYCADPDAEDASNIMRVISIKNYHPKIRIITQMLQYHNKAHLLNIPSWN
WKEGDDAICLAELKLGFIAQSCLAQGLSTMLANLFSMRSFIKIEEDTWQKYYLEGVSNEM
YTEYLSSAFVGLSFPTVCELCFVKLKLLMIAIEYKSANRESRSRKRILINPGNHLKIQEG
TLGFFIASDAKEVKRAFFYCKACHDDITDPKRIKKCGCKRLIYFEDEQPSTLSPKKKQRN
GGMRNSPSSSPKLMRHDPLLIPGNDQIDNMDSNVKKYDSTGMFHWCAPKEIEKVILTRSE
AAMTVLSGHVVVCIFGDVSSALIGLRNLVMPLRASNFHYHELKHIVFVGSIEYLKREWET
LHNFPKVSILPGTPLSRADLRAVNINLCDMCVILSANQNNIDDTSLQDKECILASLNIKS
MQFDDSIGVLQANSQGFTPPGMDRSSPDNSPVHGMLRQPSITTGVNIPIITELAKPGKLP
LVSVNQEKNSGTHILMITELVNDTNVQFLDQDDDDDPDTELYLTQPFACGTAFAVSVLDS
LMSATYFNDNILTLIRTLVTGGATPELEALIAEENALRGGYSTPQTLANRDRCRVAQLAL
LDGPFADLGDGGCYGDLFCKALKTYNMLCFGIYRLRDAHLSTPSQCTKRYVITNPPYEFE
LVPTDLIFCLMQFDHNAGQSRASLSHSSHSSQSSSKKSSSIHSIPSTANRPNRPKSRESR
DKQNATRMNRMGQEKKWFTDEPDNAYPRNIQIKPMSTHMANQINQYKSTSSLIPPIREVE
DEC
NT seq 3792 nt   +upstreamnt  +downstreamnt
atggcaaatggtggcggcggcggcggcagcagcggcggcggcggcggcggcggcggaggc
agcagtcttagaatgagtagcaatatccacgcgaaccatctcagcctagacgcgtcctcc
tcttcttcctcttcatcctcctcctcgtcctcggtccacgagcccaagatggatgcgctc
atcatcccggtgaccatggaggtgccgtgcgacagccggggccaacgcatgtggtgggct
ttcctggcctcctccatggtgactttcttcgggggcctcttcatcatactgctctggcgg
acgctcaagtacctgtggaccgtttgctgccactgcgggggcaagacgaaggaggcccag
aagattaacaatggctcaagccaggcggatggcactctcaagccagtggacgaaaaagag
gaggcggtggcagccgaggtcggctggatgacttctgtgaaggactgggcgggggtgatg
atatctgcccagacgctgaccggcagagtcctggtggtcttagtctttgctctcagcatt
ggtgcacttgtaatatacttcatagattcgtcaaagagccgctctgcagactctttgatc
ccaatagaatcctgccagaatttctacaaagatttcacgttacagatcgacatggctttc
aacgtgttcttccttctctactttggcttgcggtttattgcagccaatgataagctgtgg
ttctggctggaagtgaactctgtagtagatttcttcacagttcccccagtgtttgtgtct
gtgtacttaaacagaagttggcttggtttgagatttttaagagctctcagactgatccag
ttttcagaaattttgcagtttctgaatattcttaaaacaagtaattccatcaagctggtg
aatctgctctccatatttatcagcacatggctaacagcagctgggttcatccatttggtg
gagaattcaggggacccatgggaaaatttccaaaacaaccaggctcttacatactgggaa
tgtgtctatttactcatggttaccatgtccactgttggctatggggacgtgtatgcaaaa
accacacttgggcgtctcttcatggtcttcttcatcctcgggggactggccatgtttgcc
agctacgtccctgaaatcatagagttaataggaaaccgcaagaaatacgggggctcatat
agcgcggtcagtgggagaaagcacattgtggtctgtggacatatcactctggagagtgtt
tccaacttcctgaaggactttctgcacaaggaccgggacgatgtcaacgtggagatcgtt
tttcttcacaacatttcccctaacctggagcttgaagctctgttcaaacgacattttact
caggtggaattttatcagggttcagtcctcaatccacatgatcttgcaagagtcaagata
gagtcagcagatgcatgcctcatccttgccaataagtactgcgctgaccctgatgctgaa
gatgcctccaacatcatgagagtaatctccataaagaactaccatccgaagataagaatc
atcactcagatgctgcagtatcacaacaaggcccatctgctaaacatcccgagctggaat
tggaaagagggtgatgatgcaatctgcctcgcagagctgaagctggggttcatcgcccag
agctgcctggctcagggcctctccaccatgctcgccaacctcttctccatgaggtcattt
ataaagattgaggaagacacatggcagaaatactacctggaaggagtctcaaatgaaatg
tacacagaatatctctctagtgccttcgtgggtctgtccttccctactgtttgtgagctg
tgttttgtgaagctcaagctcctaatgatagccattgagtacaagtctgctaaccgcgag
agccgaagccgaaagcgtatattaattaatcctggaaaccaccttaagatccaagaaggt
actttaggatttttcatcgcaagtgatgccaaagaagttaaaagggcatttttttactgc
aaggcctgtcatgatgacatcacagatcccaaaagaataaaaaaatgtggctgcaaacgg
ctgatatattttgaagatgagcagccctcaacgctgtcaccaaaaaaaaagcagcggaac
ggaggtatgcggaattcacccagctcctcgcccaaactgatgaggcatgaccccttgtta
attcccggcaatgatcagattgacaacatggactccaacgtgaagaagtatgactctact
gggatgtttcactggtgcgcacccaaagagatagagaaagtcatcctgacccgaagtgaa
gctgccatgactgtcctgagtggccatgttgtggtctgcatctttggtgatgtcagctca
gccctgattggcctccggaacctggtgatgccactacgtgccagcaactttcattaccac
gagctcaagcacatcgtgtttgtgggctccattgagtacctcaagcgggaatgggagacg
cttcataacttccccaaagtgtccatattgcctggtacgccattaagtcgggctgattta
agggccgtcaacatcaacctctgtgacatgtgcgttatcctgtcagccaatcagaataat
attgatgatacttcgctgcaggacaaggaatgcatcttggcgtcactcaacatcaaatct
atgcagtttgatgacagcattggggtcttgcaggctaattcccaaggtttcacgcctcca
ggaatggacagatcctctccagacaacagcccagtgcacgggatgttacgccagccatcc
atcacgactggggtcaacatccctatcatcactgaactagctaaacctggcaagttgcct
ttggtatcagtcaatcaggaaaaaaacagtgggacacacattctaatgataactgaactg
gtgaacgatactaatgttcagtttttggaccaagacgatgatgatgaccccgacacagaa
ctgtacctcacgcagccattcgcatgtgggacagcatttgccgtcagtgtcctggactcg
ctcatgagtgcgacatacttcaacgacaatatccttaccctgatacggaccctggtgacc
ggaggagccacgccagagctcgaggctctgattgctgaggagaatgcgcttcgagggggc
tacagcactccccagacactggccaacagggaccgctgccgagtagcccagttagcactg
ctggatgggccctttgcagacttaggggatggtggttgttatggtgatctgttctgcaaa
gctctgaaaacatataatatgctttgttttggaatttatcggctgagagatgctcatctc
agcacccctagccaatgcacaaaaaggtacgtcatcaccaaccccccatacgagtttgag
cttgtgccgacggacctgatcttctgcttaatgcagtttgaccacaacgccggccagtcg
cgggccagtctctcccattcctcccactcgtcccagtcctccagcaagaagagctcgtcc
attcactccatcccatccacagcaaaccgaccgaaccggcccaagtcccgggagtcccga
gacaaacagaatgcaacaaggatgaatagaatgggccaagaaaagaaatggtttacagat
gaaccggataatgcctatcccagaaacattcaaatcaagcccatgagtacccacatggct
aaccagatcaaccaatataaatccacaagcagcttgattccaccaatcagagaagttgaa
gatgaatgttga

DBGET integrated database retrieval system