KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518086
Entry
107518086         CDS       T06036                                 

Gene name
PTCH1
Definition
(RefSeq) LOW QUALITY PROTEIN: protein patched homolog 1
  KO
K06225  patched 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04024  cAMP signaling pathway
ray04340  Hedgehog signaling pathway
ray04360  Axon guidance
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107518086 (PTCH1)
   04024 cAMP signaling pathway
    107518086 (PTCH1)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    107518086 (PTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518086 (PTCH1)
   05205 Proteoglycans in cancer
    107518086 (PTCH1)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    107518086 (PTCH1)
SSDB
Motif
Pfam: Patched Sterol-sensing
Other DBs
NCBI-GeneID: 107518086
NCBI-ProteinID: XP_016014960
LinkDB
Position
Unknown
AA seq 1449 aa
MASTGNAAEPEDRGGGGSCSGAPGRPAGGGRRRRTGGLRRHTAPDRDYLHRPSYCDAAFA
LEQISKGKATGRKAPLWLRAKFQRLLFKLGCYIQKNCGKFLVVGLLIFGAFAVGLKAANL
ETNVEELWVEVGGRVSRELNYTRQKIGEEAMFNPQLMIQTPKEEGANVLTTEALRQHLDS
ALQASRVHVYMYNRQWKLEHLCYKSGELITETGYMDQIIEYLYPCLIITPLDCFWEGAKL
QSGTAYLLGKPPLQWTNFDPLEFLEELKKINYQVDSWEEMLNKAEVGHGYMDRPCLNPAD
PDCPTTAPNKNATKPLDMALVLNGGCHGLSRKYMHWQEELIVGGTVKNSTGKLVSAHALQ
TMFQLMTPKQMYEHFKGYEYVSHINWNEDKAAAILEAWQRTYVEVVHQSVAQNSTQKVLS
FTTTTLDDILKSFSDVSVIRVASGYLLMLAYACLTMLRWDCSKSQGAVGLAGVLLVALSV
AAGLGLCSLIGISFNAATTQVLPFLALGVGVDDVFLLAHAFSETGQNKRIPFEDRTGECL
KRTGASVALTSISNVTAFFMAALIPIPALRAFSLQAAVVVVFNFAMVLLIFPAILSMDLY
RREDRRLDIFCCFTSPCVSRVIQVEPQAYTEPHDSTRSSPPPPYSSHSFAHETQITMQST
VQLRTEYDPHTHVYYTTAEPRSEISVQPVTLTQDTLSCQSPESTSSTRDLLSQFSDSSLH
CLEPPCTKWTLSSFAEKHYAPFLLKPKAKVMVIFLFLGLLGVSLYGTTRVRDGLDLTDIV
PRETREYDFIAAQFKYFSFYNMYIVTQKADYPNIQHLLYDLHKSFSNVKYVMLEENKQLP
KMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQ
LTKRRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQANIRPHRPEWVHDKADYMPETRL
RIPAAEPIEYAQFPFYLNGLRDTSDFVEAIEKVRTICNNYTSLGLSSYPNGYPFLFWEQY
IGLRHWLLLSISVVLACTFLVCAVFLLNPWTAGIIVTVLALMTVELFGMMGLIGIKLSAV
PVVILIASVGIGVEFTVHVALAFLTAIGDKNRRAVLALEHMFAPVLDGAVSTLLGVLMLA
GSEFDFIVRYFFAVLAILTILGVLNGLVLLPVLLSFFGPYPEVSPANGMNRLPTPSPEPP
PSVVRFAVPPCHANNGSDSSDSEYSSQTTVSGISEELRQYEAQQGAGGPAHHVIVEATEN
PVFARSTVVHPEARHHPPSNPRQQPHPDSGPLPPGRPGQQPQREPLREGLRPPPYRPRRD
AFEISTEGHSGPSNRDRMGPRGARSHNPRHPAFTAMGSSLPGYCQPITTVTASASVTVAV
HPQPAPGPGRNPRGGLCPGYEDYPETDPGLFEDPHVPFSVRCERRDSKVEVIELQDVECE
ERPRGSGSS
NT seq 4350 nt   +upstreamnt  +downstreamnt
atggcttcgactggtaacgccgcggagcccgaggaccggggcggcggcggcagctgcagc
ggggctccggggcggccggccggcggcgggaggcgcagacggaccggggggctgcgccgc
cacactgcgccggaccgggactatctgcaccggcccagctactgcgacgccgccttcgct
ctggagcagatttccaaggggaaagctactggccgaaaagcgccgctgtggctgagagcg
aagtttcagagactcttatttaaactgggttgttacattcaaaaaaactgcggcaaattc
ttggttgtgggcctcctcatatttggggccttcgctgtgggattaaaggcagctaatctg
gagaccaacgtggaggagctgtgggtggaagttggtggacgagtgagtcgcgaattaaat
tatactcgccagaagattggagaagaggctatgtttaatcctcaactcatgattcagacc
ccgaaagaagaaggtgctaatgtcctgaccacagaagcactccgccaacatctggattcg
gcactccaggccagccgggtccacgtttatatgtataacaggcagtggaaattagaacat
ttgtgttacaaatctggagaacttattacagaaacaggttacatggatcagataatagaa
tatctttacccttgtttaatcattacacctttggactgcttttgggaaggggccaagtta
caatcagggacagcgtacctactaggtaagcctcctttgcagtggacaaactttgaccct
ttggaattcctagaagagttaaagaaaataaactatcaagtggacagctgggaggaaatg
ctgaataaggcagaagttggtcatggttacatggaccggccctgcctcaatccggctgat
ccagactgccccaccaccgcccccaataaaaatgcaaccaaacctcttgatatggccctt
gttttgaatggcggatgtcatgggttatccaggaagtatatgcactggcaggaggagctg
attgtgggtggcacggtcaagaacagcactgggaagcttgtcagtgcccatgccttgcag
accatgtttcagttaatgactcccaagcagatgtacgaacacttcaaggggtacgagtat
gtttcgcatatcaactggaatgaggataaggccgcggccatcctagaggcttggcagagg
acctatgtggaggtggttcatcaaagcgtcgcccagaattccactcagaaggtgctttcc
tttaccacgacaaccctggacgacatcctcaaatccttctcagatgtcagtgtcatccga
gtggccagtggctacttactgatgcttgcctatgcctgtttaaccatgctgcgctgggac
tgctccaagtcccagggtgccgtggggctggctggcgtcctgttggttgcactgtcagtg
gctgcaggattgggcctgtgctcattgatcgggatttcctttaacgctgcaacaactcag
gttttgccatttcttgctcttggtgttggtgtggacgatgttttccttctggcacatgca
tttagtgaaacaggacagaataaaaggatcccttttgaggacaggaccggggagtgcctc
aagcgcacaggagccagcgtggccctcacgtccatcagcaatgtcacagccttctttatg
gccgcattgatcccgattcccgctctgcgggccttttccctccaggcggctgtcgtagtg
gtgttcaattttgctatggttctgctcatttttcctgccattctcagcatggatttgtat
cgacgtgaggacaggagattggatattttctgctgttttacaagcccctgcgtcagcaga
gtgattcaggttgaacctcaggcctacacggagcctcatgatagcacccgctccagcccc
ccgcccccctacagcagccacagcttcgcccacgagacacagatcaccatgcagtccaca
gtgcagctccgcacggagtacgacccacatacacatgtgtactacaccaccgctgagccg
cgctccgagatctccgtgcagcctgtcaccctgacacaggacaccctcagctgccagagc
cccgagagcactagctccacaagggacctgctctcccagttctccgactccagcctgcac
tgccttgagcccccttgcaccaagtggacactctcatcttttgccgagaaacactatgct
cctttcctcttgaaaccaaaagccaaggtcatggtgatctttcttttcctgggcttgctg
ggggtcagcctttatgggaccacccgagttcgcgacgggctggaccttactgacattgtg
cctcgggaaaccagagaatatgactttattgctgcacagtttaaatacttttctttctac
aacatgtatatagtcacccagaaagcagactacccgaatatccagcacttactttatgac
cttcacaagagtttcagtaatgtgaagtatgtcatgttggaagaaaataaacagcttccc
aaaatgtggctgcactacttcagagactggctccaaggacttcaggatgcattcgacagt
gactgggaaactgggaaaatcatgccaaacaattacaaaaatggatcagacgatggggtc
cttgcctataaactcctggtgcagactggcagccgcgataaacccatcgacatcagtcag
ttgactaaacggcgcctggtggatgcagacggcatcattaatcccagtgctttctacatc
tacctgaccgcttgggtcagcaatgaccccgtggcttatgctgcctcccaggccaacatc
cggcctcaccgtcctgagtgggtccacgacaaagccgactatatgccggaaaccaggcta
agaatcccagcagcagagcccattgaatatgctcagttccctttctacctcaatggcttg
cgtgacacctccgacttcgtggaagcgattgaaaaagtcagaaccatctgcaacaactac
acaagcctgggcctctccagctaccccaacggctaccccttcctcttctgggagcagtac
atcggcctccgccactggctcctgctgtccatcagcgtggtgctggcctgcacgtttttg
gtgtgtgccgtcttcctgctgaacccttggacggccgggatcattgtgacggtcctggct
ttgatgacggttgagctctttggcatgatgggcctcatcggaatcaagctcagcgcggtg
cctgtggtcatcctgattgcgtccgttggcataggagtggagtttaccgttcacgttgct
ctggcctttctcacagccattggtgataagaaccgcagggccgtgcttgccctggagcac
atgtttgcacctgttctggatggggctgtttctactctgctcggagtgctgatgctggca
ggatcagaatttgatttcattgtcaggtatttctttgctgtcctggcaatcctaacaatc
ctgggtgttctcaatgggctggttttgcttccagtccttttgtccttcttcggaccgtat
cctgaggtatctccagcaaacgggatgaaccggctgcccactccttccccagagccgccc
cccagtgtggtccgctttgctgtgcccccttgccatgcgaacaacgggtctgattcctct
gactcagagtacagttctcaaacgacggtgtcaggcatcagtgaggagcttcggcagtat
gaggcccagcagggcgctgggggccctgcccaccacgtgatcgtggaagccacagaaaac
cccgtctttgcccgctccactgtggtccatcctgaagcaagacatcacccgccttcgaac
cctcgacagcagccccacccggactctgggcccttgccacctggacgcccaggccaacag
ccccagagggaacctctcagagaaggcttacgaccgcctccttacagaccgcgcagagac
gcttttgaaatttctactgaagggcattctggccctagcaatagggaccgcatgggcccc
cgaggagcccgctctcacaaccctcggcacccagcattcactgccatgggtagctccttg
cccggctactgccagcctatcaccacagtgacggcctcagcctctgtaactgttgctgtg
cacccccagcctgcccccgggcctgggcgaaacccccgagggggcctctgcccgggctat
gaggactaccccgagacggaccccgggctgttcgaggacccccacgtgcctttcagcgtg
cggtgtgagaggagggattccaaggtggaggtcattgagctacaggacgtggagtgtgag
gagaggccccggggcagcggctccagctga

DBGET integrated database retrieval system