KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518120
Entry
107518120         CDS       T06036                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 isoform X1
  KO
K05405  interleukin 6
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01523  Antifolate resistance
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04066  HIF-1 signaling pathway
ray04068  FoxO signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04218  Cellular senescence
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04623  Cytosolic DNA-sensing pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04640  Hematopoietic cell lineage
ray04657  IL-17 signaling pathway
ray04659  Th17 cell differentiation
ray04668  TNF signaling pathway
ray04672  Intestinal immune network for IgA production
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05010  Alzheimer disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05133  Pertussis
ray05134  Legionellosis
ray05135  Yersinia infection
ray05142  Chagas disease
ray05143  African trypanosomiasis
ray05144  Malaria
ray05146  Amoebiasis
ray05152  Tuberculosis
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05321  Inflammatory bowel disease
ray05323  Rheumatoid arthritis
ray05332  Graft-versus-host disease
ray05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107518120 (IL6)
   04668 TNF signaling pathway
    107518120 (IL6)
   04066 HIF-1 signaling pathway
    107518120 (IL6)
   04068 FoxO signaling pathway
    107518120 (IL6)
   04151 PI3K-Akt signaling pathway
    107518120 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107518120 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107518120 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107518120 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    107518120 (IL6)
   04620 Toll-like receptor signaling pathway
    107518120 (IL6)
   04621 NOD-like receptor signaling pathway
    107518120 (IL6)
   04623 Cytosolic DNA-sensing pathway
    107518120 (IL6)
   04625 C-type lectin receptor signaling pathway
    107518120 (IL6)
   04659 Th17 cell differentiation
    107518120 (IL6)
   04657 IL-17 signaling pathway
    107518120 (IL6)
   04672 Intestinal immune network for IgA production
    107518120 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518120 (IL6)
   05202 Transcriptional misregulation in cancer
    107518120 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    107518120 (IL6)
   05321 Inflammatory bowel disease
    107518120 (IL6)
   05332 Graft-versus-host disease
    107518120 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107518120 (IL6)
   05020 Prion disease
    107518120 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    107518120 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107518120 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107518120 (IL6)
   04931 Insulin resistance
    107518120 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    107518120 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107518120 (IL6)
   05135 Yersinia infection
    107518120 (IL6)
   05133 Pertussis
    107518120 (IL6)
   05134 Legionellosis
    107518120 (IL6)
   05152 Tuberculosis
    107518120 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107518120 (IL6)
   05161 Hepatitis B
    107518120 (IL6)
   05171 Coronavirus disease - COVID-19
    107518120 (IL6)
   05164 Influenza A
    107518120 (IL6)
   05162 Measles
    107518120 (IL6)
   05168 Herpes simplex virus 1 infection
    107518120 (IL6)
   05163 Human cytomegalovirus infection
    107518120 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107518120 (IL6)
   05169 Epstein-Barr virus infection
    107518120 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    107518120 (IL6)
   05144 Malaria
    107518120 (IL6)
   05142 Chagas disease
    107518120 (IL6)
   05143 African trypanosomiasis
    107518120 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107518120 (IL6)
   01523 Antifolate resistance
    107518120 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:ray04052]
    107518120 (IL6)
Cytokines and growth factors [BR:ray04052]
 Cytokines
  Interleukins
   107518120 (IL6)
SSDB
Motif
Pfam: IL6 DUF4924 IL11 IL23 GCSF
Other DBs
NCBI-GeneID: 107518120
NCBI-ProteinID: XP_016015011
LinkDB
Position
Unknown
AA seq 213 aa
MPQGPPLTSYQRGAFRPVAFSLGLLLVMATAFPVPSGEDSKDDTNSNRPQPTSPNQTENL
IKSIFLEISEVRNKMCGNDDSCKNSKEALTENNLNLPKMVEKDGCFQSGFNQETCLKKIT
TGLLEFQIYLDYLQNKFEENAKAMQMRTKALVQVLKQKVKNPDEITTPEPTTNSSLLAKL
QSQSEWLQTTTIHLILRSLEDFLQFTQRSVRIM
NT seq 642 nt   +upstreamnt  +downstreamnt
atgccacaaggtcctcctttgacatcctatcaaagaggcgccttcaggccagtcgccttc
tccctggggctgctcctagtgatggctactgctttcccggttccctcgggagaagattcc
aaagatgataccaactcaaacagaccacaacccacctctccaaaccaaaccgaaaacctc
attaagtccatcttccttgaaatctctgaagtgagaaataagatgtgtggcaacgatgac
tcatgtaaaaacagcaaggaggcactgacagaaaacaacctgaaccttccaaaaatggta
gaaaaagatggatgcttccaatcgggattcaatcaggagacctgcttgaagaaaatcact
accggtctcctggagtttcagatatacctggactacctccagaacaagtttgaggaaaac
gccaaggcgatgcagatgcgaaccaaagccctggtccaggtgctgaagcagaaggtaaag
aatccggatgagataaccacccccgagccaaccacaaactccagcctgctggctaagctg
cagtcgcagagcgagtggctgcagaccacgacgattcacctcatcctgcgaagccttgag
gatttcctgcagttcacccagagatctgtccggataatgtag

DBGET integrated database retrieval system