KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518128
Entry
107518128         CDS       T06036                                 

Definition
(RefSeq) cytochrome c
  KO
K08738  cytochrome c
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01524  Platinum drug resistance
ray04115  p53 signaling pathway
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04932  Non-alcoholic fatty liver disease
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05014  Amyotrophic lateral sclerosis
ray05016  Huntington disease
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05134  Legionellosis
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05222  Small cell lung cancer
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107518128
   04215 Apoptosis - multiple species
    107518128
   04115 p53 signaling pathway
    107518128
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518128
  09162 Cancer: specific types
   05210 Colorectal cancer
    107518128
   05222 Small cell lung cancer
    107518128
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107518128
   05012 Parkinson disease
    107518128
   05014 Amyotrophic lateral sclerosis
    107518128
   05016 Huntington disease
    107518128
   05017 Spinocerebellar ataxia
    107518128
   05020 Prion disease
    107518128
   05022 Pathways of neurodegeneration - multiple diseases
    107518128
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107518128
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107518128
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107518128
   05134 Legionellosis
    107518128
   05152 Tuberculosis
    107518128
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107518128
   05161 Hepatitis B
    107518128
   05160 Hepatitis C
    107518128
   05164 Influenza A
    107518128
   05162 Measles
    107518128
   05168 Herpes simplex virus 1 infection
    107518128
   05163 Human cytomegalovirus infection
    107518128
   05167 Kaposi sarcoma-associated herpesvirus infection
    107518128
   05169 Epstein-Barr virus infection
    107518128
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107518128
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    107518128
SSDB
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Other DBs
NCBI-GeneID: 107518128
NCBI-ProteinID: XP_016015022
LinkDB
Position
Unknown
AA seq 105 aa
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITW
GEETLMEYLENPKKYIPGTKMIFAGIKKSGERADLIAYLKKATKE
NT seq 318 nt   +upstreamnt  +downstreamnt
atgggtgatgttgagaagggcaagaagatttttgttcagaagtgtgcccagtgccatact
gtggaaaagggaggcaagcacaagactgggccaaatctccatggtctgtttgggcgaaag
acaggtcaggcccctggattttcttacacggatgccaacaagaacaaaggcatcacctgg
ggagaggagacactgatggagtatttggagaatcccaagaagtacatccctggaacaaaa
atgatctttgctggcattaagaagtctggagaaagggcagacttgatagcttatctcaaa
aaagctaccaaggagtaa

DBGET integrated database retrieval system