KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518638
Entry
107518638         CDS       T06036                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK isoform X1
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04064  NF-kappa B signaling pathway
ray04072  Phospholipase D signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04380  Osteoclast differentiation
ray04611  Platelet activation
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray05152  Tuberculosis
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05171  Coronavirus disease - COVID-19
ray05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    107518638 (SYK)
   04072 Phospholipase D signaling pathway
    107518638 (SYK)
   04151 PI3K-Akt signaling pathway
    107518638 (SYK)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    107518638 (SYK)
   04625 C-type lectin receptor signaling pathway
    107518638 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    107518638 (SYK)
   04662 B cell receptor signaling pathway
    107518638 (SYK)
   04664 Fc epsilon RI signaling pathway
    107518638 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    107518638 (SYK)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107518638 (SYK)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    107518638 (SYK)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107518638 (SYK)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    107518638 (SYK)
   05168 Herpes simplex virus 1 infection
    107518638 (SYK)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107518638 (SYK)
   05169 Epstein-Barr virus infection
    107518638 (SYK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107518638 (SYK)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     107518638 (SYK)
Protein kinases [BR:ray01001]
 Non-receptor tyrosine kinases
  SYK family
   107518638 (SYK)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase SH2 Kdo RIO1
Other DBs
NCBI-GeneID: 107518638
NCBI-ProteinID: XP_016015977
LinkDB
Position
Unknown
AA seq 631 aa
MATGMADSANHLPFFFGNITREEAEDYLVQGGMSDGLYLLRQSRNYLGGFALSVAHGRKA
HHYTIERELNGTYAIAGGRTHASPAELCQYHSQESDGLICLLKKPFNRPPGVQPKTGPFE
DLKENLIREYVKQTWNLQGQALEQAIISQKPQLEKLIATTAHEKMPWFHGNISRDESEQI
VLIGSKTNGKFLIRARDNNGSYALCLLHEGKVLHYRIDKDKTGKLSIPDGKKFDTLWQLV
EHYSYKPDGLLRVLTVPCQKIGGQTGNINFGTRPQLPSAHPGTWSVGGIISRIKSRSFPK
PGHKKTSSSQEKRPDSSVMFNPYEPEQGLSFSERDALPMDTEVYESPYADPEEIRPKEVY
LDRKLLTLEDKELGSGNFGTVKKGYYQMKKGAKTVAVKILKNEANDPTLKDELLAEANVM
QQLDNPYIVRMIGICEAESWMLVMEMAELGPLNKYLQQNRHVKDKNITELVHQVSMGMKY
LEECNFVHRDLAARNVLLVTQHYAKISDFGLSKALRADENYYKAQTHGKWPVKWYAPECI
NYYKFSSRSDVWSFGVLMWEAFSYGQKPYRGMKGSEVSAMLEKGERMGCPVGCPREMYEL
MNLCWTYDVENRPGFAAVELRLRNYYYDVVN
NT seq 1896 nt   +upstreamnt  +downstreamnt
atggccacaggcatggccgacagtgccaaccacctgccattcttcttcggaaatatcacc
cgtgaggaggctgaggactacctggtccagggtggaatgagtgatgggctctacctgctg
cgccagagccgtaattacctgggtggcttcgccctttcggtggcacatgggcgcaaggca
caccactacaccatcgagcgggagttgaatgggacctatgccatcgcaggtggcaggacg
catgccagccccgctgagctctgccaataccactctcaggagtcagatggcctcatctgc
ctcctcaaaaaacccttcaaccggccacctggggtgcagcccaagaccggaccctttgag
gacctgaaggagaacctcatccgggagtacgtgaagcagacctggaacctacagggccaa
gctctggaacaggccattatcagccagaagcctcagctggagaagctgatcgccaccaca
gcccatgaaaaaatgccctggtttcacgggaacatttctcgggatgaatctgagcaaatt
gtcctgataggttcaaagacaaatggaaaatttttgatcagggccagggacaacaacgga
tcctacgccttgtgtctgctgcacgagggcaaagtgctacactaccgcattgacaaggac
aagacagggaagctttccatccccgacggaaagaagtttgacacactctggcagctagtc
gaacattattcttataaaccagatggcttgttaagagtccttacagttccatgtcaaaaa
attggcgggcagactggaaatattaattttggaactcgtccacaacttccaagtgcccat
cctgggacttggtcagtgggtggaataatctcaagaatcaaatcacgctccttcccaaag
cctggccacaaaaagacctcctcgtctcaagagaaacggccagacagctctgtgatgttt
aatccctatgagccagagcaaggactctcgttctcagaaagagatgccttgcccatggac
acagaagtgtatgaaagcccctatgcagaccccgaagagatcaggcccaaggaggtctac
ctggaccggaagctgttgaccctggaggacaaggaactgggctctggtaactttggaact
gtgaagaagggctactaccagatgaaaaaaggtgcaaaaacagtcgctgtgaaaatcctg
aagaatgaagccaatgacccgacccttaaagatgaactgttagcagaagctaacgtcatg
cagcaactcgacaacccttacattgtgcgcatgatcgggatttgtgaagccgagtcctgg
atgctggttatggagatggcggaactcggtccactcaataaatatttacagcagaacagg
cacgtcaaggataagaatattacagaactggttcatcaggtttctatgggaatgaaatat
ttggaggagtgcaattttgtgcacagagatcttgctgccagaaatgtattgctggttact
caacattatgccaagatcagcgattttggactttccaaagcacttcgtgctgatgaaaac
tactacaaggcccagactcatgggaagtggcctgtgaagtggtacgctccagaatgtatc
aactactacaagttctccagcaggagtgatgtctggagcttcggagtgttaatgtgggag
gcattttcctatgggcagaaaccatatcgggggatgaaaggaagtgaagtttctgctatg
ctggagaaaggagagaggatggggtgccctgtgggatgtccgagagagatgtatgagctg
atgaacctgtgctggacgtatgatgtggagaacaggcccgggtttgcagcggtggaactg
cggctgcgcaattactattacgacgtggtcaactaa

DBGET integrated database retrieval system