KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518727
Entry
107518727         CDS       T06036                                 

Gene name
CDC25C
Definition
(RefSeq) M-phase inducer phosphatase 3
  KO
K05867  M-phase inducer phosphatase 3 [EC:3.1.3.48]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04110  Cell cycle
ray04114  Oocyte meiosis
ray04914  Progesterone-mediated oocyte maturation
ray05170  Human immunodeficiency virus 1 infection
ray05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    107518727 (CDC25C)
   04114 Oocyte meiosis
    107518727 (CDC25C)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    107518727 (CDC25C)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107518727 (CDC25C)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107518727 (CDC25C)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107518727 (CDC25C)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:ray03036]
    107518727 (CDC25C)
   03400 DNA repair and recombination proteins [BR:ray03400]
    107518727 (CDC25C)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     107518727 (CDC25C)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107518727 (CDC25C)
 Protein tyrosine phosphatases (PTPs)
  Class III PTPs
   CDC25s
    107518727 (CDC25C)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     107518727 (CDC25C)
DNA repair and recombination proteins [BR:ray03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    107518727 (CDC25C)
SSDB
Motif
Pfam: Rhodanese Omega-toxin
Other DBs
NCBI-GeneID: 107518727
NCBI-ProteinID: XP_016016148
LinkDB
Position
Unknown
AA seq 424 aa
MSAELFSSREEGSPGLGPSFRSHQRKILNLLLERDTSFTICPDLPRTPVDKLFGDSANQS
ILFGETPKRCLDLSNLSSEELSATRLTTPADLDETGHLDSSGPQEIQLVQINHHQHLVKC
SPAQLLCSTPNALDHGNRKKDAICSSSTNKENDNGNLVKSEMKYLGSPITTVPKLDENPE
QGENQAEEILGESMEFSLEDQEEVKGLCLKKTVSFRDINAIQMLEEDPNQGYLTGDFSKV
CALPTVSGRHQDLKYINPETVAALLLGKFQGLIEKFYIIDCRYPYEYLGGHIQGALNLYS
QEELYNFFLKMPLVPLDTQKRIIIVFHCEFSSERGPRMCRSLREEDRALNQYPALYYPEL
YILKGGYRDFFPEYKELCEPQSYCPMHHQDHKAELLRCRSQSKAWEGERQLQEQIALLVK
DVNP
NT seq 1275 nt   +upstreamnt  +downstreamnt
atgtctgcagaactcttttcatcaagagaggagggaagtcctggattaggacccagtttt
aggtcccatcagagaaaaatattaaatctgcttctggagagagatacttcctttactatc
tgcccagatcttcctagaactccagtggacaaactctttggtgattcggcaaaccaaagc
atcttatttggagaaaccccaaaacgttgccttgatctttcgaatcttagcagtgaggag
ttgtctgccacccgtcttaccactcctgcagaccttgatgaaactggacacttggattct
tcaggacctcaggaaatacagttagtgcaaataaatcatcaccagcaccttgtaaaatgc
agcccggcacagctgctttgtagcactccgaatgctttggaccatggcaacaggaagaaa
gatgcaatatgtagctcatctacaaataaagaaaatgacaatggaaacttggtgaaaagt
gaaatgaaatatctgggcagtcctatcactacagttccaaaattagatgaaaacccagaa
caaggggaaaaccaagcagaggagattttaggtgaatcgatggagttttctctggaagat
caagaagaggtcaagggtttatgtctaaagaagacagtctctttccgtgacattaatgcc
attcaaatgctagaggaagatcctaatcaagggtacctgactggtgatttttccaaggta
tgtgcgctgccaactgtgtcagggagacaccaagatctgaagtacatcaacccagaaaca
gtggctgccttactgttggggaaattccagggtctgattgagaagttttatatcatcgat
tgccgctatccgtatgagtacctgggaggacatattcagggagccttaaacttgtacagt
caggaagaactgtataacttctttctgaagatgcctcttgtccctttggatacccagaaa
agaataatcatcgtgttccactgtgaattctcctcagagaggggtcccagaatgtgccgc
tctctgagagaagaggacagggccctgaaccagtatcctgcattatactatcctgagctg
tatatcctcaaagggggctatagagacttctttccagaatataaggagctgtgcgaacca
cagagctactgtcctatgcatcaccaagaccacaaggctgagctgctgagatgtcgaagc
cagagcaaagcatgggaaggggaacggcagctgcaggagcagattgctttgctagtgaag
gatgtgaacccatga

DBGET integrated database retrieval system