KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518733
Entry
107518733         CDS       T06036                                 

Gene name
EGR1
Definition
(RefSeq) early growth response protein 1
  KO
K09203  early growth response protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04371  Apelin signaling pathway
ray04912  GnRH signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray05020  Prion disease
ray05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107518733 (EGR1)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    107518733 (EGR1)
   04928 Parathyroid hormone synthesis, secretion and action
    107518733 (EGR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107518733 (EGR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107518733 (EGR1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107518733 (EGR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107518733 (EGR1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 SP/KLF family and related proteins
    107518733 (EGR1)
SSDB
Motif
Pfam: DUF3432 DUF3446 zf-H2C2_2 zf-C2H2 zf-C2H2_4 zf-C2HC_2 Zf_RING zf-BED zf-H2C2_5
Other DBs
NCBI-GeneID: 107518733
NCBI-ProteinID: XP_016016158
LinkDB
Position
Unknown
AA seq 541 aa
MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLSAAGAPEGSSG
GSSGSSGGGGGGGGSSSSSSSAFNPQGEAGEQPYEHLTSESFPDISLNNEKVLVETSYPS
QTTRLPPITYTGRFSLEPAPNSGNTLWPEPLFSLVSGLVSMTNPPATSSSAPSPAASSSS
SASQSPPLSCAVQSSDSSPIYSAAPTFPTPNTDIFPEPQSQAYPGSAGTALQYPPPAYPA
AKGSFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESRTQQPSLTPLSTIKAFATQSGSQ
DLKALNTTYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFSRSDELTRHIRIH
TGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQK
DKKADKGVVASSATPSLSSYSSPVATSYTSPVTTSYPSSATTSYPSPVPTSYSSPGSSTY
PSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTTTFSPRTIEI
C
NT seq 1626 nt   +upstreamnt  +downstreamnt
atggccgcagccaaggccgagatgcagctgatgtccccactgcagatttctgacccgttc
ggctcctttcctcactcgcccaccatggacaactaccctaaactggaggagatgatgctg
ctgagcaacggggctccccagttcctcagtgccgccggggcccccgaggggagcagcggt
ggcagcagcggcagcagcgggggcggtggaggtggagggggcagcagcagcagcagcagc
agcgccttcaaccctcaaggggaggcgggcgagcagccctacgagcacctgacctcagag
tcttttcctgacatctctctgaataacgagaaggttctggtggagacaagttaccccagc
caaaccacccggctgccccccattacctacaccggccgcttctcactggagcctgctccc
aacagtggcaacactttgtggcctgagcccctcttcagcctggtcagcggcctcgtgagc
atgaccaacccacctgccacctcatcctcagcaccatctccagcggcctcctcttcatct
tcagcctcccagagtccacccctgagctgcgcagtgcagtccagtgacagcagccccatt
tactcagcggcacccacctttcccacgcctaacactgacatcttccctgagccacagagc
caggcctatcctggctcggcaggtactgcgctccagtacccacctcctgcctaccctgct
gccaagggtagtttccaggtccctatgattcctgactatctgtttccacaacagcagggg
gacctgggcctgggcaccccagaccagaagcccttccagggcctggagagccgcacccag
cagccttcactcactccactctcaaccatcaaggcctttgccacacagtctggctcccaa
gacctgaaggccctcaacacgacttaccagtcccagctcatcaaacccagccgcatgcgc
aagtaccctaaccggcccagcaagacgccaccccatgaacgcccctacgcctgccctgta
gagtcctgtgaccgccgcttctctcgttcagatgagctcacccgccacattcgcatccac
actggccagaagcccttccagtgtcgcatttgcatgcgcaacttcagccgcagtgaccac
ctcaccactcacatccgcacccacacaggagagaagcccttcgcttgtgacatctgtggg
aggaaatttgccaggagcgatgaacgcaagaggcacaccaagatccacttgcggcagaag
gacaaaaaagcagacaaaggtgttgtggcctcttctgccaccccctccctctcttcctac
tcctcgccagtggctacctcctatacctccccggtcactacctcttacccatcctcagcc
accacctcatacccatcacctgtgcccacctcctactcctctcctggctcttcaacctac
ccatcccctgtgcacagtggtttcccctctccctcagtggccaccacatactcctctgta
ccccctgctttcccggcccaagtcagcagcttcccttcttcagctgtcaccaactccttc
agcgcctccacagggctttcggacatgacaacaacattttctcccaggacaattgaaatt
tgctaa

DBGET integrated database retrieval system