KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518789
Entry
107518789         CDS       T06036                                 

Gene name
RYR3
Definition
(RefSeq) LOW QUALITY PROTEIN: ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04371  Apelin signaling pathway
ray04713  Circadian entrainment
ray04921  Oxytocin signaling pathway
ray04970  Salivary secretion
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107518789 (RYR3)
   04020 Calcium signaling pathway
    107518789 (RYR3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107518789 (RYR3)
  09154 Digestive system
   04970 Salivary secretion
    107518789 (RYR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107518789 (RYR3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107518789 (RYR3)
   05012 Parkinson disease
    107518789 (RYR3)
   05020 Prion disease
    107518789 (RYR3)
   05022 Pathways of neurodegeneration - multiple diseases
    107518789 (RYR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107518789 (RYR3)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107518789 (RYR3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 107518789
NCBI-ProteinID: XP_016016286
LinkDB
Position
Unknown
AA seq 4869 aa
MAEGGEGGEDEIQFLRTEDEVVLQCIANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAILLRHSFSRMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSISNATIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTILSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRGKSDTKSTAFSFRASKEIKEKLDSSHKRDIEGMGVPEIKYGDSICFVQHIAS
GLWVTYKAQDAKTPRLGPLKRKVILHQEGHMDDGLTLQRCQHEESQAARIIRNTTALFSQ
FISGNSRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMQHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILIESPEALNLIAEGHIRSIISLLDKHGRNHKVLDV
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINNVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLKSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVVS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDTEGIRDLLGT
TQFLSQASFIPCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLSKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYVLLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADPAVEKVSIDKIQFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVALGADDQAFVFEGSRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICSLGLSQIGR
MNLGMDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVVRID
GTMDSPPCLKVTHKTFGTQNSNASMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSQATTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCMVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVATSQRSSRSNVDLEIGCLLDLAMGMLSFSANGRELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKTAMPLSAAIFKSEEKNPVPQCPPRLDVQTIQPVLW
SRMPSSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMQFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLANAKE
RKLMMKNEYIIPINSTTRKIRLYPDEFKRHGLPGVGLRTCLKPGFRFSTPCVVMTSEEHQ
KQSPEIPLEILKTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSGETEEGAEKEEVTQVEEKAVEAGEKASKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPDEIREELYDFHEDLLTHCGVPLEGEEEEEED
SSWTGKLRAFLYKIRGPPKPEKEQPTEEEERCPTTLKELISQTMIRWAQEDQIQDAELVR
MMFTLLRRQYDSVGELLRALRKTYSISQASVNDTIGLLAALGQIRCLLSVRMGKEEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGAEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLE
KVVTYLAGCGLQSCAMLLARGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGCKREVSTEDNEDEEIVHM
GNAIMSFYSALIDLLGRCAPEMHLIRTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPS
LNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQAFLLHLLEVGFLPDLRASASLDT
VSLSTTEAVLALNRYVCSAVLPLLTRCAPLFAGTEHYTSLIDSTLQTIYRLSKGRSLTKA
QRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLP
SGWGSYGLAVEEELHLTEKLFWGIFDSFSHKKYDPDLFRMALPCLSAIAGALPPDYLDTR
ISATLEKQISVDTDGNFDPKPINTMNFPLPEKLEYIVTKYAEHSHDKWACDKSQNGWKYG
ISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGDTLAQQREN
EKLRSMSQASQGNSYSPAPLDLSNVVLSKELQGMVEVVAENYHNIWAKKKKLELESKGGG
SHPLLVPYDTLTAKEKFRDREKAQDLFKFLQVNGIVVSRGMKDMELDASSMEKRFAYKFL
KKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSS
PLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTV
MRSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPIL
TSIFEHVAQHQFGADLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAA
IPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEEMCPDIPQLEGLMKEINDLAESG
ARYTEMPHVIEVILPMLCNYLSYWWERGPEHLPFSTGPWCTKVTSEHLSVILGNILKIIN
NNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKADSK
GDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNSRSNWLKSPDADSDQLFRMVAEVFIL
WCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYS
IQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSHRDTDEEVKEHLRNNLHLQEKSD
DPAVKWQLNLYKDVLKSEEPFNPERTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSK
QRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYFFEEKLVQDLAKSPKVEAE
EEEEVEKQPDPLHQIILHFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEEEDKE
KTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNA
GVQQKMLDYLREKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRER
GEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESI
SDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVV
GFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVE
SSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGILSKKEFQKAMEGQKQYTQSEIDF
LLSCAEADENDMFNYIDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESV
LNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEK
MELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYTSEIEGEEEDDKSLESASA
FAMACASVKRNVANFLKRATLKNLRKQYRKVKKMTVKELVRVFFSFFWMMFVGLFQLFFT
ILGGIFQILWNTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDAVEAERAEVTDPGIT
TELVHFIKGEKGNADIMSDLFGFHSKKEGGVKHGPEVGLGDLSEIIGKDEPPTLESTVRK
KRKAQAAEMKAADESEGKVEPEKADTEDGEKEDAARESEQAKALWAEATKKKKRRRGQKV
EKPEAFMANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEE
AEDVANLWHSFNDEEEEEAMVFFVLQESTGYMAPTLRALAVIHTVISLVCVVGYYCLKVP
LVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINK
YGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDNS
FLYLAWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVV
YLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMCVGVRAGGGIGDEIEDPAGDP
YEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYF
DTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCF
RKQYEDQLG
NT seq 14610 nt   +upstreamnt  +downstreamnt
atggccgaagggggagaaggcggcgaggacgagatccagttcctgcggactgaagatgaa
gtggttctccagtgcatcgcgaacattcacaaggagcaaaggaagttctgcctagcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacttcagaagccaagtatgttcct
ccagatctctgcgtctgcaattttgtgctggaacagtccctctctgtcagagccctacag
gaaatgctcgccaacacaggtgaaaatggcggcgaaggggcagcacaagggggtggccac
aggaccctgctgtatggccacgcgattctcctgcggcactctttcagcagaatgtatcta
acatgtttgactacatcgagatcccagacagataaacttgcctttgatgtaggtctacgg
gaacatgccacaggggaagcctgttggtggaccatacatcctgcttccaaacagaggtcc
gaaggagaaaaagttcgaattggagatgacctcatccttgtcagcgtgtcttctgaaaga
taccttcatctctccatatcaaatgccaccatacaagtggatgcctcttttatgcaaaca
ctctggaatgtacatcctacatgctcaggaagtagcatcgaagaaggatacctacttggt
gggcatgtggtacgtcttttccatggtcacgatgagtgtctgacgatattatctacagac
cagaatgattcccagcacaggaggatattctatgaagcaggaggagctgggacacgagcc
agatctctctggagagtggaaccccttcggataagctggagtggcagtaacatcaggtgg
ggccaggctttccgactgcggcacctcaccacaggccactacctggccctgacagaggac
caaggccttatactgcaagaccggggaaagtcagacaccaagtccacagccttctctttc
agggcatcaaaggaaatcaaggagaaattggattccagtcacaagcgagatatagaaggc
atgggagttccagaaataaagtatggagattctatctgctttgtccagcatatagccagt
ggtctgtgggtgacctacaaagcacaggatgccaagacaccccgccttggacctctgaaa
agaaaggtcatactccatcaggaaggccacatggatgatgggttaacactgcagagatgc
cagcatgaggagtcccaggctgctcggatcatccggaacacaaccgccttattcagccag
tttataagtgggaacagtcgcacagctgcccccatcaccctgccaatagaagaagtcctg
cagactttgcaggacttgatcgcctacttccagcccccggaggaggagatgcagcatgaa
gacaagcagaacaagctccgctcgctcaaaaacagacagaaccttttcaaggaagaagga
atgttggcccttgtgttaaattgcattgatcgcttaaatatctacaatagtgtagcacac
tttgcaggaattgcaagggaagagagtggcatggcctggaaagaaattctgaaccttctg
tacaaattgttggccgccctcattcgtggaaacagaaacaattgtgctcaattctccaat
aaccttgattggctaatcagcaaattagacagactggaatcttcctcaggtatcttggaa
gttttgcactgcatcctgattgaaagcccagaagccttaaatctgatagcggagggccac
atcaggtccatcatctccctgttggataagcatggacggaatcacaaggttctggatgtg
ctgtgctccctctgtctctgcaatggagttgcagtgagagccaaccaaaatctgatctgt
gacaacttgcttccccggagaaacctgctcctgcagacacggctgattaataatgtgaca
agtattcgaccaaatatcttcctgggagtcgctgagggctcagcgcagtacaagaagtgg
tactttgagctcattatcgaccaagtggaccccttcctgacagcagagcccacgcacttg
cgagtgggctgggcctcttcctcaggctacgctccgtaccccggaggcggagaaggatgg
ggaggcaatggtgttggcgatgacctgtactcctatggctttgatggacttcatctttgg
tcaggccgcattcccagagccgtagcctccatcaaccagcacctcctgaaatcagatgac
gtggtgagctgttgcctggacctcggagtgcccagcatctctttccgcatcaatgggcag
cctgtgcaggggatgtttgagaacttcaacacagatgggctcttcttccctgtggtgagc
ttttcagcgggtgtcaaagtacgtttcctgatgggtggacgtcatggagaatttaagttt
ctgcctccttctggctatgccccttgctatgaagccttacttcccaaagaaaagatgaga
ttggagcctgtcaaagaatataaacgtgatactgaaggcatcagagacctgttgggtacc
acccagtttctctcccaagcctctttcatcccatgccccatagacaccagtcaggtggtt
ttgccacctcacctagagaagatccgagacagactggctgaaaacatccatgagctttgg
ggaatgaataaaatagagcttggctggacttttggcaagatacgggatgacaataaaaga
caacacccctgccttgtggagttttcaaagctgcctgaaactgagaagaattataaccta
cagatgtcaactgaaaccttaaaaaccctcctagccttggggtgccacattgctcatgtt
aatccagctgctgaagaggatctcaagaaggtcaaactgtccaaaaactacatgatgtcc
aatggctataagccagcccctttggatttgtctgatgtgaagctcttacctcctcaggaa
attttagtggataaacttgcagaaaatgcacataatgtttgggcaaaggacagaattaaa
caaggatggacttatggcattcaacaggatttgaagaacaaaagaaatccccgtctggtg
ccatatgtgttactggatgagcgtaccaaaaagtcaaacagagacagccttcgtgaagct
gttcggacttttgttggttacggctataatatcgagccatcagatcaagaactagcggac
ccagctgtggagaaagtcagcatcgacaagattcaattcttccgggtagagcgatcctat
gcagtgagatctggaaagtggtatttcgagtttgaggtggtgactggaggagacatgcgt
gtcggctgggccaggccaggctgtcggcctgacgttgcactgggggccgatgaccaagcc
tttgtgttcgaaggcagccggggccagcgctggcatcaagggagtgggtattttggccgt
acctggcagccaggagatgtggttggatgtatgattaacctggatgatgcttcaatgatc
ttcacactgaatggggagctgctgatcaccaacaaaggctctgaacttgcctttgctgat
tacgagatcgagaatggctttgtgcccatctgctctctgggactgtctcagatcggccgc
atgaatctcgggatggatgccagtaccttcaagttttataccatgtgcggcctccaagag
ggctttgagccttttgctgtcaacatgaaccgagatgttgcaatgtggttcagcaagcgc
ctgccaacatttgtcaatgtgccaaaggatcatccacatatagaggtcgtgaggatcgat
ggcaccatggacagccctccatgcctcaaagtgacccacaagacgtttggcacacagaat
agcaatgccagcatgatctactgccgcctgagcatgcccgtcgagtgccactcgtccttc
agccacagcccctgtctggacagtgaagctttccagaaaaggaaacagatgcaagaaata
ctctctcaagcaaccacacaatgctactacgcaatccgcatctttgctggacaggacccc
tcctgtgtctgggtcggatgggtgactcctgactatcacttatacagtgaaaagtttgac
ctgaataaaaactgtatggtgactgttactctgggggatgaaagaggccgggtccatgaa
agtgtaaagcgcagcaactgctacatggtctggggtggggacattgtggccacttctcaa
cgatcaagtcgcagcaacgtggacctggagatcggctgcctcttggatctggcaatgggc
atgttgtccttctcagccaatgggagagaacttggcacctgctaccaggtggagccgaat
accaaagtgtttccagcagtcttcctgcagcctacgagtacttctttgtttcagtttgaa
cttgggaagctgaagactgcaatgcccctgtcggcagccatatttaagagtgaagaaaag
aacccagttccacagtgtccacctcgcctggacgtccaaaccatccagcctgtgctctgg
agccgcatgcccagcagtttcctgaaggtggagacggagcgggtgagcgagcgccatggc
tgggtggtgcagtgcctggagcccctgcagatgatggcgctccacatccccgaggagaac
aggtgtgtggatatcctggagctctgcgagcaggaggacctgatgcagttccactaccac
acgctgagactctacagtgccgtttgtgccctgggaaacagccgagtagcctatgccctg
tgcagccacgtggacctctcccagctcttctacgccattgataacaagtacctccccggc
ctccttcggtctggtttctatgacctgctcatcagcatccatctggccaatgctaaggag
agaaagctgatgatgaagaatgagtacatcatccccattaacagcaccaccaggaaaatc
cgcctgtacccagacgagttcaagaggcatgggctacctggggtgggcctgagaacgtgc
ctcaagccagggttcaggttctccaccccttgtgttgtcatgaccagtgaggagcaccag
aagcagagccccgagattcccttggagattctcaagacgaaggcgctgagcatgctgaca
gaggccgtgcaatgcagtggggctcacatccgggaccctgttgggggatccgtggagttc
cagtttgtgcctgtgctgaaactcattggaacactgctggtcatgggggtgtttgatgac
gatgacgttcggcagatcctcctcctgatcgatccctctgtgtttggggagcacagtgga
gagacagaagagggagcagagaaggaagaagtgactcaggtagaggagaaggcagtggag
gctggggaaaaggccagcaaggaggctccagtcaaaggcttgttacagacccgattacca
gagtccgtcaagctgcagatgtgtgagctcctcagctatctctgtgactgtgagctgcag
caccgagtggaggccattgtggcctttggcgacatttatgtctccaagctccaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaacatgtctgcggccctgaccgcc
cggaagaccaaggagttccggtcacctccacaggagcagattaacatgcttcttaacttt
caactgggagagaactgcccctgcccagatgagatccgggaggaactgtatgacttccat
gaggaccttcttactcactgtggagttcccctggagggggaggaagaagaggaagaggat
agctcctggactggaaaactccgtgccttcttgtacaaaatcagaggccctcccaagcca
gagaaggagcagccaacagaggaggaagagagatgccctaccacgctgaaggagctcatc
tcccagacaatgattcgctgggcccaggaggaccagatccaggatgcagaactggtccgg
atgatgttcacgctcctgcggaggcagtacgacagcgtcggggagctgctgcgggcgctg
cgcaagacctacagcatcagccaggcctccgtgaatgacaccatcggcctgctggccgcc
ctcggccagattcgctgcctcctcagtgtcaggatgggcaaggaagaggagctgcttatg
atcaatgggctgggagacataatgaacaacaaggtgttctaccagcacccaaacctcatg
cgagtcctcggcatgcacgagacagtgatggaggtgatggtgaacgtgctgggtgcggag
aaatcccagattgcttttccaaagatggttgccagctgttgccgcttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgttcgagcatctaagttacctgctggag
aacagcagtgttggtctagcctccccttcgatgaggggttccactccactggatgtggca
gcttcctccgtgatggacaacaacgagttagcgctgggcttagaggaaccagacctcgag
aaggtggtgacctacttggcaggctgtggtctacagagctgcgccatgcttctggccaga
gggtaccctgacgtcggctggaaccccatcgaaggggagcgctacctgtccttcctgagg
tttgctgtcttcgtgaacagcgaaagtgtggaagaaaatgctagtgtcgtggtcaagctg
ctcatcagacgtccagagtgcttcggcccggctctgcgaggtgaaggaggaaacggtctg
ttggcagccatgcaaggcgccatcaagatctctgagaacccagccctggacctcccctct
cagggatgcaagagagaagtcagcacggaggacaatgaagatgaagagatcgtgcacatg
ggcaatgcaattatgtcattttattcagctcttatagatctcctgggccgctgtgctcct
gaaatgcaccttatccggacaggaaaaggggaagccatcaggatcaggtcaattctacgc
tcccttgtccccacggaggacttggttggaatcatcagcatccccttgaaactaccctcc
ctgaacaaagacgggtcggtgagtgagccagatatggccgccaacttctgccctgaccac
aaggcaccgatggtgctgttcttggaccgcgtttatggcattaaggatcaagcttttctg
ctccacttgctggaggttggatttttgccggacttaagagcctctgcctctctagataca
gtctcgctgagcaccacagaggccgtgctggcgctaaataggtatgtgtgttccgccgtg
ctcccgctgctcacgagatgcgcccctctctttgctggaacagaacactacacctctttg
atcgattctacactgcagacaatatacaggctttccaagggacgttccctcaccaaagct
cagagggacaccatagaagaatgtttgcttgccatttgcaatcacttgaggccttccatg
ttgcagcagctcctgcgacgtcttgtttttgatgtgccccaactcaacgaatactgcaaa
atgcctcttaagcttctgacaaatcactatgaacagtgctggaagtattactgtctgcct
tcaggatgggggagctatggtctcgctgtggaagaagaattacacctgacagaaaagctc
ttctgggggatttttgactccttctctcataagaagtatgacccagaccttttccgaatg
gccctgccttgtctcagtgctatagctggggccttgccaccagattatttagatactaga
atctcagccacactggagaagcagatctcagtggatacagatggcaactttgaccccaaa
cctatcaacaccatgaatttccccttgcctgaaaaattggaatacatcgtcaccaagtat
gccgagcattcacatgataaatgggcctgcgacaagagtcagaatggatggaaatatgga
atttccctggatgaaaatgtgaagacccatccattgatcagaccttttaagacgttaaca
gagaaggagaaagaaatttatcgctggccggccagagagtccctgaaaaccatgctggct
gtgggttggactgtggagaggaccaaagagggagacactctagcccaacagcgggaaaat
gagaagcttcgaagcatgtcccaggccagccagggcaacagctacagccctgctcccctg
gacctgtccaacgtggtcctctccaaagagctccagggaatggtggaggtggtggctgag
aactatcataacatctgggccaagaagaagaagctggagctagagagcaaaggtggtggc
agtcaccctctcttggtaccatatgacaccttgactgccaaagaaaaatttagggaccga
gagaaggcacaggacctgtttaaattcctccaggtgaacggcattgtggtttctagaggt
atgaaggatatggagctggatgcctcctccatggagaagaggtttgcctataaatttttg
aagaagatcctgaaatatgttgattccgctcaagagtttattgcccatttggaagccatt
gtcagcagtgggaaaactgaaaagtcgccccatgaccaggagatcaaattctttgccaaa
gttcttctcccactggtggaccagtacttcaccaatcaccgcctctatttcctgtcatcc
cctctgaagccgctgagcagcagcgggtacgcctcccataaggagaaagagatggtggcc
agcctgttctgcaaacttgctgctcttgttcgacacaggatttccctctttgggagtgac
tctactacaatggtgagctgtcttcacatcttagctcaaacacttgacacaaggactgtc
atgaggtcaggctccgagctggtcaaagccggcttacgagccttcttcgaaaatgctgca
gaagacttagagaagacttcggaaaacctgaagctcgggaagtttacccattccagaacg
cagattaaaggtgtttctcagaacatcaactacaccacggtggcgctgctccccatcctg
acgtccatcttcgagcatgtcgctcaacatcagttcggggcggatttactcttgggtgat
gtgcagatttcatgctaccacatcctgtgcagcctctactcccttgggacaggaaagaac
atctatgttgaaagacaacgtcctgcccttggagaatgtctggcttcactggcagctgcc
atcccagtggcattcctggagcccactcttaaccgctacaatccactctcagtcttcaac
accaaaacccccagagagagatctattctggggatgccagacacagtggaagagatgtgt
cctgacatcccccagctagaaggcctgatgaaggaaatcaacgacctggctgagtcaggg
gcccggtacaccgagatgccccacgtcatcgaggtgatcttgcccatgctctgcaactac
ctgtcctactggtgggagcgagggcctgagcacctgcccttcagcacggggccctggtgc
accaaggtcacctctgaacaccttagtgtcatcctgggcaacattctgaaaatcatcaac
aacaacctgggcatcgacgaggcctcctggatgaagcgcattgcagtgtatgctcagcca
atcatcagcaaagccaggcctgacctgctgagaagccacttcatcccaaccctggagaag
ctaaagaaaaaggccgtcaagactgtgcaggaggaggagcagctgaaagccgacagcaaa
ggggacactcaggaggcagagctcctcatcctggacgagttcgcagtcctctgcagagac
ctctacgccttctaccccatgctgatccgctacgtggacaacagcagatctaactggctc
aaaagccctgatgctgattctgaccagctcttccgtatggtggcagaagtcttcatcctg
tggtgtaaatctcataacttcaagagggaagagcaaaattttgtgattcagaatgaaatt
aataatttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaagta
aagtctggaggacaggatcaggaacggaagaagaccaagcgaaggggagacttgtattcc
atccagacctccctcatcgtggccgcactcaagaaaatgctgcccattggtttgaacatg
tgcaccccaggcgatcaggagctgatctccctcgcgaaatcacgatacagccatagggac
acagacgaagaggtgaaggaacatctgcggaataacttgcacttgcaggaaaagtctgat
gacccagctgtaaagtggcagctgaatctctacaaggatgtgttgaagagtgaagaacca
ttcaatccagaaaggacagtggaacgtgtgcagagaatttcagcagctgtcttccacctg
gagcaggtggagcagcctttgaggtccaagaaggcggtgtggcacaaactgttatcaaag
cagcggaaacgggcagtggtggcctgtttcaggatggcccctctctacaacctgcccagg
caccgctctattaacctcttcctccatggctatcagagattttggatagaaacagaggag
tatttctttgaagagaaactagtacaggatttggctaaatctcccaaggtggaagcggag
gaggaggaggaggtggaaaagcaaccagacccacttcatcagatcattctccatttcagc
cgcaatgctctcacggagaggagtaaattggaagacgaccctttgtatacctcctattcc
agcatgatggccaagagttgtcagagtggagaggatgaggaagaagaggaagataaggag
aaaacatttgaagagaaagaaatggaaaagcagaaaaccctgtatcagcaggctcggctg
catgagcgcggagccgcagagatggtccttcagatgataagcgccagtaaaggtgagatg
agccccatggtggttgagactctgaagctggggatcgctatcctgaatggaggcaacgct
ggtgtgcagcagaaaatgttagattacctaagggagaaaaaggatgccggattctttcaa
agcctttctggtcttatgcagtcttgcagtgtccttgatttgaatgcatttgagaggcag
aataaagctgaaggcctggggatggttaccgaggaaggaacactcattgtccgtgaacgt
ggcgaaaaagtactccagaatgacgagtttacacgagacctctttagattcctacagtta
ctttgtgaaggacataacagcgactttcagaacttcctgcggactcaaatgggcaacacc
accactgtgaatgtcatcatcagcactgtggactaccttctgcgtcttcaggaatcgatc
agtgatttctactggtattattcagggaaggacatcatcgacgaatctggacagcacaat
ttttccaaagctctggcggtcaccaagcaaattttcaattctcttacagaatatatccag
ggcccttgcattgggaaccaacagagcctggctcacagcaggctgtgggacgcggtggtc
ggcttcctccatgtatttgctaacatgcagatgaaactctctcaggattccagtcagatc
gagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtccctc
ctggaaggaaatgtggtaaatggaactattggcaagcagatggttgacacactggtagag
tcatctaccaatgtagaaatgatcttgaaattttttgacatgttcttgaaacttaaagac
ttaaccagctcagacaccttcaaagaatacgacccagatggcaaagggattctctccaaa
aaagaattccagaaggccatggaagggcaaaaacagtacacacagtcagagattgacttt
ctcctttcgtgtgcagaagctgatgagaatgacatgtttaattacattgattttgtggac
cggttccacgagccagccaaggacatagggtttaacgtggcagtgttattgacaaatctc
tccgagcatatgccaaatgattctcgccttaaatgcctgttggatccagcagaaagtgtg
ctaaattacttcgaaccatacttaggacgcattgagattatgggcggggccaagaaaatt
gagcgtgtttattttgagatcagcgaatccagtcgaactcaatgggaaaagccccaagtg
aaggaatctaagcgacagtttatctttgatgttgtcaacgaaggtggagagcaagaaaaa
atggaactgtttgtgaacttctgtgaagacaccatctttgaaatgcagttagcatctcag
atctctgaatctgactcagctgacaggccagaagaagaggaggaagatgaagattcttct
tacacctcagaaattgagggtgaagaggaagatgacaagtctcttgagtctgcctctgcg
ttcgccatggcctgtgcctcagtgaagagaaacgttgccaactttctaaagagggcaacc
ctgaagaacctcaggaagcaatacaggaaggtgaaaaaaatgactgtgaaggagctggtg
cgggtgttcttctcgttcttctggatgatgtttgtggggctattccaactgttcttcacc
atattgggaggaatatttcagatcctctggaacacagtgtttggagggggcctggttgag
ggggcaaagaacatcagggtgaccaagatcctaggggacatgcctgacccgacccaattt
ggtatccacgatgatgctgtggaggccgagagggcggaagtgactgacccaggtatcacc
actgaactagtacatttcataaagggtgagaagggaaatgcagatattatgtcagatctt
tttggattccactcaaagaaagaaggtggcgtaaagcatgggcccgaagtgggtttgggt
gacctctctgagattattggcaaggatgaaccccccacgctagagagtactgtacggaag
aaaaggaaagcacaggcagcagagatgaaagcagcagatgaatcggaaggaaaagtagaa
cctgagaaggcagacacggaagatggggagaaggaggatgcagccagagaaagcgagcaa
gccaaggccctgtgggcggaagcaaccaaaaagaaaaagcgacggcgtggccagaaagtc
gagaagcctgaagccttcatggccaatttctttaaggggctggaaatctatcagaccaag
ttattgcactacctggccagaaatttctacaacctgaggttcctggctctgtttgtagcc
ttcgctatcaacttcatcctgctgttttacaaggtcaccgaagaacctttagaagaagag
gcagaggacgttgcgaacctgtggcattcctttaatgacgaggaagaggaggaagcgatg
gtgttctttgtcctgcaggagagcacggggtacatggccccaacactgcgggctctggcc
gttatccacaccgtcatctctttagtctgcgtggtgggctattactgcctgaaggtccct
ttggtggtattcaaaagggaaaaagaaattgccaggaagctggagtttgatggcctgtat
atcactgaacaaccatctgaagatgacatcaaggggcaatgggaccgcttggtaatcaac
acaccatcttttcctaataactattgggacaagtttgtgaagagaaaggtgatcaacaag
tatggagatctttatggagcagaacgcattgccgaactcctgggtttggacaaaaacgcc
cttgactttagcccagtggaagagacgaaagcagaggcggcgtctctagtgtcatggctg
agttccatcgacatgaagtaccacatctggaagctaggagttgtttttactgacaactcc
tttctctaccttgcctggtacacaaccatgtccatccttggccactacaataacttcttc
ttcgctgctcatctgctggacatcgccatgggcttcaagacactgaggactattctgtca
tctgtaactcacaacggcaaacagctggttctgactgtcggtctcctggctgtggtggtt
tatctctataccgtggtggctttcaacttctttcgcaagttctacaacaagagtgaagat
gacgacgagcccgatatgaagtgtgatgacatgatgacgtgttacctattccacatgtgc
gtgggagtgagagctggaggcggcatcggcgatgaaatcgaagaccctgctggtgaccct
tatgaaatgtaccgcatcgtctttgacattacatttttcttctttgtcattgtcatcttg
ctggccatcattcaaggtcttattattgatgcttttggagagctaagagaccagcaggaa
caagtgagagaagatatggagactaaatgtttcatctgtgggattggcaatgattacttt
gacacgactcctcatggttttgaaacgcatacattacaagagcacaacttagccaactac
ttgttcttcctgatgtatctgattaacaaagacgaaacagagcacacgggtcaggaatct
tatgtctggaagatgtaccaggaaaggtgttgggatttcttcccagctggtgactgcttt
cgaaaacaatacgaagatcagcttggataa

DBGET integrated database retrieval system