KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518789
Entry
107518789         CDS       T06036                                 

Gene name
RYR3
Definition
(RefSeq) LOW QUALITY PROTEIN: ryanodine receptor 3
  KO
K04963  ryanodine receptor 3
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04371  Apelin signaling pathway
ray04713  Circadian entrainment
ray04921  Oxytocin signaling pathway
ray04970  Salivary secretion
ray05010  Alzheimer disease
ray05012  Parkinson disease
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107518789 (RYR3)
   04020 Calcium signaling pathway
    107518789 (RYR3)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107518789 (RYR3)
  09154 Digestive system
   04970 Salivary secretion
    107518789 (RYR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107518789 (RYR3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107518789 (RYR3)
   05012 Parkinson disease
    107518789 (RYR3)
   05020 Prion disease
    107518789 (RYR3)
   05022 Pathways of neurodegeneration - multiple diseases
    107518789 (RYR3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107518789 (RYR3)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107518789 (RYR3)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_8
Other DBs
NCBI-GeneID: 107518789
NCBI-ProteinID: XP_016016286
LinkDB
Position
Unknown
AA seq 4869 aa
MAEGGEGGEDEIQFLRTEDEVVLQCIANIHKEQRKFCLAAEGLGNRLCFLEPTSEAKYVP
PDLCVCNFVLEQSLSVRALQEMLANTGENGGEGAAQGGGHRTLLYGHAILLRHSFSRMYL
TCLTTSRSQTDKLAFDVGLREHATGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSER
YLHLSISNATIQVDASFMQTLWNVHPTCSGSSIEEGYLLGGHVVRLFHGHDECLTILSTD
QNDSQHRRIFYEAGGAGTRARSLWRVEPLRISWSGSNIRWGQAFRLRHLTTGHYLALTED
QGLILQDRGKSDTKSTAFSFRASKEIKEKLDSSHKRDIEGMGVPEIKYGDSICFVQHIAS
GLWVTYKAQDAKTPRLGPLKRKVILHQEGHMDDGLTLQRCQHEESQAARIIRNTTALFSQ
FISGNSRTAAPITLPIEEVLQTLQDLIAYFQPPEEEMQHEDKQNKLRSLKNRQNLFKEEG
MLALVLNCIDRLNIYNSVAHFAGIAREESGMAWKEILNLLYKLLAALIRGNRNNCAQFSN
NLDWLISKLDRLESSSGILEVLHCILIESPEALNLIAEGHIRSIISLLDKHGRNHKVLDV
LCSLCLCNGVAVRANQNLICDNLLPRRNLLLQTRLINNVTSIRPNIFLGVAEGSAQYKKW
YFELIIDQVDPFLTAEPTHLRVGWASSSGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLW
SGRIPRAVASINQHLLKSDDVVSCCLDLGVPSISFRINGQPVQGMFENFNTDGLFFPVVS
FSAGVKVRFLMGGRHGEFKFLPPSGYAPCYEALLPKEKMRLEPVKEYKRDTEGIRDLLGT
TQFLSQASFIPCPIDTSQVVLPPHLEKIRDRLAENIHELWGMNKIELGWTFGKIRDDNKR
QHPCLVEFSKLPETEKNYNLQMSTETLKTLLALGCHIAHVNPAAEEDLKKVKLSKNYMMS
NGYKPAPLDLSDVKLLPPQEILVDKLAENAHNVWAKDRIKQGWTYGIQQDLKNKRNPRLV
PYVLLDERTKKSNRDSLREAVRTFVGYGYNIEPSDQELADPAVEKVSIDKIQFFRVERSY
AVRSGKWYFEFEVVTGGDMRVGWARPGCRPDVALGADDQAFVFEGSRGQRWHQGSGYFGR
TWQPGDVVGCMINLDDASMIFTLNGELLITNKGSELAFADYEIENGFVPICSLGLSQIGR
MNLGMDASTFKFYTMCGLQEGFEPFAVNMNRDVAMWFSKRLPTFVNVPKDHPHIEVVRID
GTMDSPPCLKVTHKTFGTQNSNASMIYCRLSMPVECHSSFSHSPCLDSEAFQKRKQMQEI
LSQATTQCYYAIRIFAGQDPSCVWVGWVTPDYHLYSEKFDLNKNCMVTVTLGDERGRVHE
SVKRSNCYMVWGGDIVATSQRSSRSNVDLEIGCLLDLAMGMLSFSANGRELGTCYQVEPN
TKVFPAVFLQPTSTSLFQFELGKLKTAMPLSAAIFKSEEKNPVPQCPPRLDVQTIQPVLW
SRMPSSFLKVETERVSERHGWVVQCLEPLQMMALHIPEENRCVDILELCEQEDLMQFHYH
TLRLYSAVCALGNSRVAYALCSHVDLSQLFYAIDNKYLPGLLRSGFYDLLISIHLANAKE
RKLMMKNEYIIPINSTTRKIRLYPDEFKRHGLPGVGLRTCLKPGFRFSTPCVVMTSEEHQ
KQSPEIPLEILKTKALSMLTEAVQCSGAHIRDPVGGSVEFQFVPVLKLIGTLLVMGVFDD
DDVRQILLLIDPSVFGEHSGETEEGAEKEEVTQVEEKAVEAGEKASKEAPVKGLLQTRLP
ESVKLQMCELLSYLCDCELQHRVEAIVAFGDIYVSKLQANQKFRYNELMQALNMSAALTA
RKTKEFRSPPQEQINMLLNFQLGENCPCPDEIREELYDFHEDLLTHCGVPLEGEEEEEED
SSWTGKLRAFLYKIRGPPKPEKEQPTEEEERCPTTLKELISQTMIRWAQEDQIQDAELVR
MMFTLLRRQYDSVGELLRALRKTYSISQASVNDTIGLLAALGQIRCLLSVRMGKEEELLM
INGLGDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGAEKSQIAFPKMVASCCRFLCYF
CRISRQNQKAMFEHLSYLLENSSVGLASPSMRGSTPLDVAASSVMDNNELALGLEEPDLE
KVVTYLAGCGLQSCAMLLARGYPDVGWNPIEGERYLSFLRFAVFVNSESVEENASVVVKL
LIRRPECFGPALRGEGGNGLLAAMQGAIKISENPALDLPSQGCKREVSTEDNEDEEIVHM
GNAIMSFYSALIDLLGRCAPEMHLIRTGKGEAIRIRSILRSLVPTEDLVGIISIPLKLPS
LNKDGSVSEPDMAANFCPDHKAPMVLFLDRVYGIKDQAFLLHLLEVGFLPDLRASASLDT
VSLSTTEAVLALNRYVCSAVLPLLTRCAPLFAGTEHYTSLIDSTLQTIYRLSKGRSLTKA
QRDTIEECLLAICNHLRPSMLQQLLRRLVFDVPQLNEYCKMPLKLLTNHYEQCWKYYCLP
SGWGSYGLAVEEELHLTEKLFWGIFDSFSHKKYDPDLFRMALPCLSAIAGALPPDYLDTR
ISATLEKQISVDTDGNFDPKPINTMNFPLPEKLEYIVTKYAEHSHDKWACDKSQNGWKYG
ISLDENVKTHPLIRPFKTLTEKEKEIYRWPARESLKTMLAVGWTVERTKEGDTLAQQREN
EKLRSMSQASQGNSYSPAPLDLSNVVLSKELQGMVEVVAENYHNIWAKKKKLELESKGGG
SHPLLVPYDTLTAKEKFRDREKAQDLFKFLQVNGIVVSRGMKDMELDASSMEKRFAYKFL
KKILKYVDSAQEFIAHLEAIVSSGKTEKSPHDQEIKFFAKVLLPLVDQYFTNHRLYFLSS
PLKPLSSSGYASHKEKEMVASLFCKLAALVRHRISLFGSDSTTMVSCLHILAQTLDTRTV
MRSGSELVKAGLRAFFENAAEDLEKTSENLKLGKFTHSRTQIKGVSQNINYTTVALLPIL
TSIFEHVAQHQFGADLLLGDVQISCYHILCSLYSLGTGKNIYVERQRPALGECLASLAAA
IPVAFLEPTLNRYNPLSVFNTKTPRERSILGMPDTVEEMCPDIPQLEGLMKEINDLAESG
ARYTEMPHVIEVILPMLCNYLSYWWERGPEHLPFSTGPWCTKVTSEHLSVILGNILKIIN
NNLGIDEASWMKRIAVYAQPIISKARPDLLRSHFIPTLEKLKKKAVKTVQEEEQLKADSK
GDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNSRSNWLKSPDADSDQLFRMVAEVFIL
WCKSHNFKREEQNFVIQNEINNLAFLTGDSKSKMSKAMQVKSGGQDQERKKTKRRGDLYS
IQTSLIVAALKKMLPIGLNMCTPGDQELISLAKSRYSHRDTDEEVKEHLRNNLHLQEKSD
DPAVKWQLNLYKDVLKSEEPFNPERTVERVQRISAAVFHLEQVEQPLRSKKAVWHKLLSK
QRKRAVVACFRMAPLYNLPRHRSINLFLHGYQRFWIETEEYFFEEKLVQDLAKSPKVEAE
EEEEVEKQPDPLHQIILHFSRNALTERSKLEDDPLYTSYSSMMAKSCQSGEDEEEEEDKE
KTFEEKEMEKQKTLYQQARLHERGAAEMVLQMISASKGEMSPMVVETLKLGIAILNGGNA
GVQQKMLDYLREKKDAGFFQSLSGLMQSCSVLDLNAFERQNKAEGLGMVTEEGTLIVRER
GEKVLQNDEFTRDLFRFLQLLCEGHNSDFQNFLRTQMGNTTTVNVIISTVDYLLRLQESI
SDFYWYYSGKDIIDESGQHNFSKALAVTKQIFNSLTEYIQGPCIGNQQSLAHSRLWDAVV
GFLHVFANMQMKLSQDSSQIELLKELLDLLQDMVVMLLSLLEGNVVNGTIGKQMVDTLVE
SSTNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGILSKKEFQKAMEGQKQYTQSEIDF
LLSCAEADENDMFNYIDFVDRFHEPAKDIGFNVAVLLTNLSEHMPNDSRLKCLLDPAESV
LNYFEPYLGRIEIMGGAKKIERVYFEISESSRTQWEKPQVKESKRQFIFDVVNEGGEQEK
MELFVNFCEDTIFEMQLASQISESDSADRPEEEEEDEDSSYTSEIEGEEEDDKSLESASA
FAMACASVKRNVANFLKRATLKNLRKQYRKVKKMTVKELVRVFFSFFWMMFVGLFQLFFT
ILGGIFQILWNTVFGGGLVEGAKNIRVTKILGDMPDPTQFGIHDDAVEAERAEVTDPGIT
TELVHFIKGEKGNADIMSDLFGFHSKKEGGVKHGPEVGLGDLSEIIGKDEPPTLESTVRK
KRKAQAAEMKAADESEGKVEPEKADTEDGEKEDAARESEQAKALWAEATKKKKRRRGQKV
EKPEAFMANFFKGLEIYQTKLLHYLARNFYNLRFLALFVAFAINFILLFYKVTEEPLEEE
AEDVANLWHSFNDEEEEEAMVFFVLQESTGYMAPTLRALAVIHTVISLVCVVGYYCLKVP
LVVFKREKEIARKLEFDGLYITEQPSEDDIKGQWDRLVINTPSFPNNYWDKFVKRKVINK
YGDLYGAERIAELLGLDKNALDFSPVEETKAEAASLVSWLSSIDMKYHIWKLGVVFTDNS
FLYLAWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGLLAVVV
YLYTVVAFNFFRKFYNKSEDDDEPDMKCDDMMTCYLFHMCVGVRAGGGIGDEIEDPAGDP
YEMYRIVFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVREDMETKCFICGIGNDYF
DTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCF
RKQYEDQLG
NT seq 14610 nt   +upstreamnt  +downstreamnt
atggccgaagggggagaaggcggcgaggacgagatccagttcctgcggactgaagatgaa
gtggttctccagtgcatcgcgaacattcacaaggagcaaaggaagttctgcctagcagcc
gagggacttgggaatcgcctgtgcttcttggaacccacttcagaagccaagtatgttcct
ccagatctctgcgtctgcaattttgtgctggaacagtccctctctgtcagagccctacag
gaaatgctcgccaacacaggtgaaaatggcggcgaaggggcagcacaagggggtggccac
aggaccctgctgtatggccacgcgattctcctgcggcactctttcagcagaatgtatcta
acatgtttgactacatcgagatcccagacagataaacttgcctttgatgtaggtctacgg
gaacatgccacaggggaagcctgttggtggaccatacatcctgcttccaaacagaggtcc
gaaggagaaaaagttcgaattggagatgacctcatccttgtcagcgtgtcttctgaaaga
taccttcatctctccatatcaaatgccaccatacaagtggatgcctcttttatgcaaaca
ctctggaatgtacatcctacatgctcaggaagtagcatcgaagaaggatacctacttggt
gggcatgtggtacgtcttttccatggtcacgatgagtgtctgacgatattatctacagac
cagaatgattcccagcacaggaggatattctatgaagcaggaggagctgggacacgagcc
agatctctctggagagtggaaccccttcggataagctggagtggcagtaacatcaggtgg
ggccaggctttccgactgcggcacctcaccacaggccactacctggccctgacagaggac
caaggccttatactgcaagaccggggaaagtcagacaccaagtccacagccttctctttc
agggcatcaaaggaaatcaaggagaaattggattccagtcacaagcgagatatagaaggc
atgggagttccagaaataaagtatggagattctatctgctttgtccagcatatagccagt
ggtctgtgggtgacctacaaagcacaggatgccaagacaccccgccttggacctctgaaa
agaaaggtcatactccatcaggaaggccacatggatgatgggttaacactgcagagatgc
cagcatgaggagtcccaggctgctcggatcatccggaacacaaccgccttattcagccag
tttataagtgggaacagtcgcacagctgcccccatcaccctgccaatagaagaagtcctg
cagactttgcaggacttgatcgcctacttccagcccccggaggaggagatgcagcatgaa
gacaagcagaacaagctccgctcgctcaaaaacagacagaaccttttcaaggaagaagga
atgttggcccttgtgttaaattgcattgatcgcttaaatatctacaatagtgtagcacac
tttgcaggaattgcaagggaagagagtggcatggcctggaaagaaattctgaaccttctg
tacaaattgttggccgccctcattcgtggaaacagaaacaattgtgctcaattctccaat
aaccttgattggctaatcagcaaattagacagactggaatcttcctcaggtatcttggaa
gttttgcactgcatcctgattgaaagcccagaagccttaaatctgatagcggagggccac
atcaggtccatcatctccctgttggataagcatggacggaatcacaaggttctggatgtg
ctgtgctccctctgtctctgcaatggagttgcagtgagagccaaccaaaatctgatctgt
gacaacttgcttccccggagaaacctgctcctgcagacacggctgattaataatgtgaca
agtattcgaccaaatatcttcctgggagtcgctgagggctcagcgcagtacaagaagtgg
tactttgagctcattatcgaccaagtggaccccttcctgacagcagagcccacgcacttg
cgagtgggctgggcctcttcctcaggctacgctccgtaccccggaggcggagaaggatgg
ggaggcaatggtgttggcgatgacctgtactcctatggctttgatggacttcatctttgg
tcaggccgcattcccagagccgtagcctccatcaaccagcacctcctgaaatcagatgac
gtggtgagctgttgcctggacctcggagtgcccagcatctctttccgcatcaatgggcag
cctgtgcaggggatgtttgagaacttcaacacagatgggctcttcttccctgtggtgagc
ttttcagcgggtgtcaaagtacgtttcctgatgggtggacgtcatggagaatttaagttt
ctgcctccttctggctatgccccttgctatgaagccttacttcccaaagaaaagatgaga
ttggagcctgtcaaagaatataaacgtgatactgaaggcatcagagacctgttgggtacc
acccagtttctctcccaagcctctttcatcccatgccccatagacaccagtcaggtggtt
ttgccacctcacctagagaagatccgagacagactggctgaaaacatccatgagctttgg
ggaatgaataaaatagagcttggctggacttttggcaagatacgggatgacaataaaaga
caacacccctgccttgtggagttttcaaagctgcctgaaactgagaagaattataaccta
cagatgtcaactgaaaccttaaaaaccctcctagccttggggtgccacattgctcatgtt
aatccagctgctgaagaggatctcaagaaggtcaaactgtccaaaaactacatgatgtcc
aatggctataagccagcccctttggatttgtctgatgtgaagctcttacctcctcaggaa
attttagtggataaacttgcagaaaatgcacataatgtttgggcaaaggacagaattaaa
caaggatggacttatggcattcaacaggatttgaagaacaaaagaaatccccgtctggtg
ccatatgtgttactggatgagcgtaccaaaaagtcaaacagagacagccttcgtgaagct
gttcggacttttgttggttacggctataatatcgagccatcagatcaagaactagcggac
ccagctgtggagaaagtcagcatcgacaagattcaattcttccgggtagagcgatcctat
gcagtgagatctggaaagtggtatttcgagtttgaggtggtgactggaggagacatgcgt
gtcggctgggccaggccaggctgtcggcctgacgttgcactgggggccgatgaccaagcc
tttgtgttcgaaggcagccggggccagcgctggcatcaagggagtgggtattttggccgt
acctggcagccaggagatgtggttggatgtatgattaacctggatgatgcttcaatgatc
ttcacactgaatggggagctgctgatcaccaacaaaggctctgaacttgcctttgctgat
tacgagatcgagaatggctttgtgcccatctgctctctgggactgtctcagatcggccgc
atgaatctcgggatggatgccagtaccttcaagttttataccatgtgcggcctccaagag
ggctttgagccttttgctgtcaacatgaaccgagatgttgcaatgtggttcagcaagcgc
ctgccaacatttgtcaatgtgccaaaggatcatccacatatagaggtcgtgaggatcgat
ggcaccatggacagccctccatgcctcaaagtgacccacaagacgtttggcacacagaat
agcaatgccagcatgatctactgccgcctgagcatgcccgtcgagtgccactcgtccttc
agccacagcccctgtctggacagtgaagctttccagaaaaggaaacagatgcaagaaata
ctctctcaagcaaccacacaatgctactacgcaatccgcatctttgctggacaggacccc
tcctgtgtctgggtcggatgggtgactcctgactatcacttatacagtgaaaagtttgac
ctgaataaaaactgtatggtgactgttactctgggggatgaaagaggccgggtccatgaa
agtgtaaagcgcagcaactgctacatggtctggggtggggacattgtggccacttctcaa
cgatcaagtcgcagcaacgtggacctggagatcggctgcctcttggatctggcaatgggc
atgttgtccttctcagccaatgggagagaacttggcacctgctaccaggtggagccgaat
accaaagtgtttccagcagtcttcctgcagcctacgagtacttctttgtttcagtttgaa
cttgggaagctgaagactgcaatgcccctgtcggcagccatatttaagagtgaagaaaag
aacccagttccacagtgtccacctcgcctggacgtccaaaccatccagcctgtgctctgg
agccgcatgcccagcagtttcctgaaggtggagacggagcgggtgagcgagcgccatggc
tgggtggtgcagtgcctggagcccctgcagatgatggcgctccacatccccgaggagaac
aggtgtgtggatatcctggagctctgcgagcaggaggacctgatgcagttccactaccac
acgctgagactctacagtgccgtttgtgccctgggaaacagccgagtagcctatgccctg
tgcagccacgtggacctctcccagctcttctacgccattgataacaagtacctccccggc
ctccttcggtctggtttctatgacctgctcatcagcatccatctggccaatgctaaggag
agaaagctgatgatgaagaatgagtacatcatccccattaacagcaccaccaggaaaatc
cgcctgtacccagacgagttcaagaggcatgggctacctggggtgggcctgagaacgtgc
ctcaagccagggttcaggttctccaccccttgtgttgtcatgaccagtgaggagcaccag
aagcagagccccgagattcccttggagattctcaagacgaaggcgctgagcatgctgaca
gaggccgtgcaatgcagtggggctcacatccgggaccctgttgggggatccgtggagttc
cagtttgtgcctgtgctgaaactcattggaacactgctggtcatgggggtgtttgatgac
gatgacgttcggcagatcctcctcctgatcgatccctctgtgtttggggagcacagtgga
gagacagaagagggagcagagaaggaagaagtgactcaggtagaggagaaggcagtggag
gctggggaaaaggccagcaaggaggctccagtcaaaggcttgttacagacccgattacca
gagtccgtcaagctgcagatgtgtgagctcctcagctatctctgtgactgtgagctgcag
caccgagtggaggccattgtggcctttggcgacatttatgtctccaagctccaggcaaat
cagaagttccgctacaatgagctcatgcaggccctgaacatgtctgcggccctgaccgcc
cggaagaccaaggagttccggtcacctccacaggagcagattaacatgcttcttaacttt
caactgggagagaactgcccctgcccagatgagatccgggaggaactgtatgacttccat
gaggaccttcttactcactgtggagttcccctggagggggaggaagaagaggaagaggat
agctcctggactggaaaactccgtgccttcttgtacaaaatcagaggccctcccaagcca
gagaaggagcagccaacagaggaggaagagagatgccctaccacgctgaaggagctcatc
tcccagacaatgattcgctgggcccaggaggaccagatccaggatgcagaactggtccgg
atgatgttcacgctcctgcggaggcagtacgacagcgtcggggagctgctgcgggcgctg
cgcaagacctacagcatcagccaggcctccgtgaatgacaccatcggcctgctggccgcc
ctcggccagattcgctgcctcctcagtgtcaggatgggcaaggaagaggagctgcttatg
atcaatgggctgggagacataatgaacaacaaggtgttctaccagcacccaaacctcatg
cgagtcctcggcatgcacgagacagtgatggaggtgatggtgaacgtgctgggtgcggag
aaatcccagattgcttttccaaagatggttgccagctgttgccgcttcctttgctatttc
tgtcgaattagccggcaaaatcagaaggccatgttcgagcatctaagttacctgctggag
aacagcagtgttggtctagcctccccttcgatgaggggttccactccactggatgtggca
gcttcctccgtgatggacaacaacgagttagcgctgggcttagaggaaccagacctcgag
aaggtggtgacctacttggcaggctgtggtctacagagctgcgccatgcttctggccaga
gggtaccctgacgtcggctggaaccccatcgaaggggagcgctacctgtccttcctgagg
tttgctgtcttcgtgaacagcgaaagtgtggaagaaaatgctagtgtcgtggtcaagctg
ctcatcagacgtccagagtgcttcggcccggctctgcgaggtgaaggaggaaacggtctg
ttggcagccatgcaaggcgccatcaagatctctgagaacccagccctggacctcccctct
cagggatgcaagagagaagtcagcacggaggacaatgaagatgaagagatcgtgcacatg
ggcaatgcaattatgtcattttattcagctcttatagatctcctgggccgctgtgctcct
gaaatgcaccttatccggacaggaaaaggggaagccatcaggatcaggtcaattctacgc
tcccttgtccccacggaggacttggttggaatcatcagcatccccttgaaactaccctcc
ctgaacaaagacgggtcggtgagtgagccagatatggccgccaacttctgccctgaccac
aaggcaccgatggtgctgttcttggaccgcgtttatggcattaaggatcaagcttttctg
ctccacttgctggaggttggatttttgccggacttaagagcctctgcctctctagataca
gtctcgctgagcaccacagaggccgtgctggcgctaaataggtatgtgtgttccgccgtg
ctcccgctgctcacgagatgcgcccctctctttgctggaacagaacactacacctctttg
atcgattctacactgcagacaatatacaggctttccaagggacgttccctcaccaaagct
cagagggacaccatagaagaatgtttgcttgccatttgcaatcacttgaggccttccatg
ttgcagcagctcctgcgacgtcttgtttttgatgtgccccaactcaacgaatactgcaaa
atgcctcttaagcttctgacaaatcactatgaacagtgctggaagtattactgtctgcct
tcaggatgggggagctatggtctcgctgtggaagaagaattacacctgacagaaaagctc
ttctgggggatttttgactccttctctcataagaagtatgacccagaccttttccgaatg
gccctgccttgtctcagtgctatagctggggccttgccaccagattatttagatactaga
atctcagccacactggagaagcagatctcagtggatacagatggcaactttgaccccaaa
cctatcaacaccatgaatttccccttgcctgaaaaattggaatacatcgtcaccaagtat
gccgagcattcacatgataaatgggcctgcgacaagagtcagaatggatggaaatatgga
atttccctggatgaaaatgtgaagacccatccattgatcagaccttttaagacgttaaca
gagaaggagaaagaaatttatcgctggccggccagagagtccctgaaaaccatgctggct
gtgggttggactgtggagaggaccaaagagggagacactctagcccaacagcgggaaaat
gagaagcttcgaagcatgtcccaggccagccagggcaacagctacagccctgctcccctg
gacctgtccaacgtggtcctctccaaagagctccagggaatggtggaggtggtggctgag
aactatcataacatctgggccaagaagaagaagctggagctagagagcaaaggtggtggc
agtcaccctctcttggtaccatatgacaccttgactgccaaagaaaaatttagggaccga
gagaaggcacaggacctgtttaaattcctccaggtgaacggcattgtggtttctagaggt
atgaaggatatggagctggatgcctcctccatggagaagaggtttgcctataaatttttg
aagaagatcctgaaatatgttgattccgctcaagagtttattgcccatttggaagccatt
gtcagcagtgggaaaactgaaaagtcgccccatgaccaggagatcaaattctttgccaaa
gttcttctcccactggtggaccagtacttcaccaatcaccgcctctatttcctgtcatcc
cctctgaagccgctgagcagcagcgggtacgcctcccataaggagaaagagatggtggcc
agcctgttctgcaaacttgctgctcttgttcgacacaggatttccctctttgggagtgac
tctactacaatggtgagctgtcttcacatcttagctcaaacacttgacacaaggactgtc
atgaggtcaggctccgagctggtcaaagccggcttacgagccttcttcgaaaatgctgca
gaagacttagagaagacttcggaaaacctgaagctcgggaagtttacccattccagaacg
cagattaaaggtgtttctcagaacatcaactacaccacggtggcgctgctccccatcctg
acgtccatcttcgagcatgtcgctcaacatcagttcggggcggatttactcttgggtgat
gtgcagatttcatgctaccacatcctgtgcagcctctactcccttgggacaggaaagaac
atctatgttgaaagacaacgtcctgcccttggagaatgtctggcttcactggcagctgcc
atcccagtggcattcctggagcccactcttaaccgctacaatccactctcagtcttcaac
accaaaacccccagagagagatctattctggggatgccagacacagtggaagagatgtgt
cctgacatcccccagctagaaggcctgatgaaggaaatcaacgacctggctgagtcaggg
gcccggtacaccgagatgccccacgtcatcgaggtgatcttgcccatgctctgcaactac
ctgtcctactggtgggagcgagggcctgagcacctgcccttcagcacggggccctggtgc
accaaggtcacctctgaacaccttagtgtcatcctgggcaacattctgaaaatcatcaac
aacaacctgggcatcgacgaggcctcctggatgaagcgcattgcagtgtatgctcagcca
atcatcagcaaagccaggcctgacctgctgagaagccacttcatcccaaccctggagaag
ctaaagaaaaaggccgtcaagactgtgcaggaggaggagcagctgaaagccgacagcaaa
ggggacactcaggaggcagagctcctcatcctggacgagttcgcagtcctctgcagagac
ctctacgccttctaccccatgctgatccgctacgtggacaacagcagatctaactggctc
aaaagccctgatgctgattctgaccagctcttccgtatggtggcagaagtcttcatcctg
tggtgtaaatctcataacttcaagagggaagagcaaaattttgtgattcagaatgaaatt
aataatttggcatttttaactggagacagcaaaagcaagatgtcaaaagccatgcaagta
aagtctggaggacaggatcaggaacggaagaagaccaagcgaaggggagacttgtattcc
atccagacctccctcatcgtggccgcactcaagaaaatgctgcccattggtttgaacatg
tgcaccccaggcgatcaggagctgatctccctcgcgaaatcacgatacagccatagggac
acagacgaagaggtgaaggaacatctgcggaataacttgcacttgcaggaaaagtctgat
gacccagctgtaaagtggcagctgaatctctacaaggatgtgttgaagagtgaagaacca
ttcaatccagaaaggacagtggaacgtgtgcagagaatttcagcagctgtcttccacctg
gagcaggtggagcagcctttgaggtccaagaaggcggtgtggcacaaactgttatcaaag
cagcggaaacgggcagtggtggcctgtttcaggatggcccctctctacaacctgcccagg
caccgctctattaacctcttcctccatggctatcagagattttggatagaaacagaggag
tatttctttgaagagaaactagtacaggatttggctaaatctcccaaggtggaagcggag
gaggaggaggaggtggaaaagcaaccagacccacttcatcagatcattctccatttcagc
cgcaatgctctcacggagaggagtaaattggaagacgaccctttgtatacctcctattcc
agcatgatggccaagagttgtcagagtggagaggatgaggaagaagaggaagataaggag
aaaacatttgaagagaaagaaatggaaaagcagaaaaccctgtatcagcaggctcggctg
catgagcgcggagccgcagagatggtccttcagatgataagcgccagtaaaggtgagatg
agccccatggtggttgagactctgaagctggggatcgctatcctgaatggaggcaacgct
ggtgtgcagcagaaaatgttagattacctaagggagaaaaaggatgccggattctttcaa
agcctttctggtcttatgcagtcttgcagtgtccttgatttgaatgcatttgagaggcag
aataaagctgaaggcctggggatggttaccgaggaaggaacactcattgtccgtgaacgt
ggcgaaaaagtactccagaatgacgagtttacacgagacctctttagattcctacagtta
ctttgtgaaggacataacagcgactttcagaacttcctgcggactcaaatgggcaacacc
accactgtgaatgtcatcatcagcactgtggactaccttctgcgtcttcaggaatcgatc
agtgatttctactggtattattcagggaaggacatcatcgacgaatctggacagcacaat
ttttccaaagctctggcggtcaccaagcaaattttcaattctcttacagaatatatccag
ggcccttgcattgggaaccaacagagcctggctcacagcaggctgtgggacgcggtggtc
ggcttcctccatgtatttgctaacatgcagatgaaactctctcaggattccagtcagatc
gagctgctgaaggaactcttggatctccttcaggacatggtggtgatgcttctgtccctc
ctggaaggaaatgtggtaaatggaactattggcaagcagatggttgacacactggtagag
tcatctaccaatgtagaaatgatcttgaaattttttgacatgttcttgaaacttaaagac
ttaaccagctcagacaccttcaaagaatacgacccagatggcaaagggattctctccaaa
aaagaattccagaaggccatggaagggcaaaaacagtacacacagtcagagattgacttt
ctcctttcgtgtgcagaagctgatgagaatgacatgtttaattacattgattttgtggac
cggttccacgagccagccaaggacatagggtttaacgtggcagtgttattgacaaatctc
tccgagcatatgccaaatgattctcgccttaaatgcctgttggatccagcagaaagtgtg
ctaaattacttcgaaccatacttaggacgcattgagattatgggcggggccaagaaaatt
gagcgtgtttattttgagatcagcgaatccagtcgaactcaatgggaaaagccccaagtg
aaggaatctaagcgacagtttatctttgatgttgtcaacgaaggtggagagcaagaaaaa
atggaactgtttgtgaacttctgtgaagacaccatctttgaaatgcagttagcatctcag
atctctgaatctgactcagctgacaggccagaagaagaggaggaagatgaagattcttct
tacacctcagaaattgagggtgaagaggaagatgacaagtctcttgagtctgcctctgcg
ttcgccatggcctgtgcctcagtgaagagaaacgttgccaactttctaaagagggcaacc
ctgaagaacctcaggaagcaatacaggaaggtgaaaaaaatgactgtgaaggagctggtg
cgggtgttcttctcgttcttctggatgatgtttgtggggctattccaactgttcttcacc
atattgggaggaatatttcagatcctctggaacacagtgtttggagggggcctggttgag
ggggcaaagaacatcagggtgaccaagatcctaggggacatgcctgacccgacccaattt
ggtatccacgatgatgctgtggaggccgagagggcggaagtgactgacccaggtatcacc
actgaactagtacatttcataaagggtgagaagggaaatgcagatattatgtcagatctt
tttggattccactcaaagaaagaaggtggcgtaaagcatgggcccgaagtgggtttgggt
gacctctctgagattattggcaaggatgaaccccccacgctagagagtactgtacggaag
aaaaggaaagcacaggcagcagagatgaaagcagcagatgaatcggaaggaaaagtagaa
cctgagaaggcagacacggaagatggggagaaggaggatgcagccagagaaagcgagcaa
gccaaggccctgtgggcggaagcaaccaaaaagaaaaagcgacggcgtggccagaaagtc
gagaagcctgaagccttcatggccaatttctttaaggggctggaaatctatcagaccaag
ttattgcactacctggccagaaatttctacaacctgaggttcctggctctgtttgtagcc
ttcgctatcaacttcatcctgctgttttacaaggtcaccgaagaacctttagaagaagag
gcagaggacgttgcgaacctgtggcattcctttaatgacgaggaagaggaggaagcgatg
gtgttctttgtcctgcaggagagcacggggtacatggccccaacactgcgggctctggcc
gttatccacaccgtcatctctttagtctgcgtggtgggctattactgcctgaaggtccct
ttggtggtattcaaaagggaaaaagaaattgccaggaagctggagtttgatggcctgtat
atcactgaacaaccatctgaagatgacatcaaggggcaatgggaccgcttggtaatcaac
acaccatcttttcctaataactattgggacaagtttgtgaagagaaaggtgatcaacaag
tatggagatctttatggagcagaacgcattgccgaactcctgggtttggacaaaaacgcc
cttgactttagcccagtggaagagacgaaagcagaggcggcgtctctagtgtcatggctg
agttccatcgacatgaagtaccacatctggaagctaggagttgtttttactgacaactcc
tttctctaccttgcctggtacacaaccatgtccatccttggccactacaataacttcttc
ttcgctgctcatctgctggacatcgccatgggcttcaagacactgaggactattctgtca
tctgtaactcacaacggcaaacagctggttctgactgtcggtctcctggctgtggtggtt
tatctctataccgtggtggctttcaacttctttcgcaagttctacaacaagagtgaagat
gacgacgagcccgatatgaagtgtgatgacatgatgacgtgttacctattccacatgtgc
gtgggagtgagagctggaggcggcatcggcgatgaaatcgaagaccctgctggtgaccct
tatgaaatgtaccgcatcgtctttgacattacatttttcttctttgtcattgtcatcttg
ctggccatcattcaaggtcttattattgatgcttttggagagctaagagaccagcaggaa
caagtgagagaagatatggagactaaatgtttcatctgtgggattggcaatgattacttt
gacacgactcctcatggttttgaaacgcatacattacaagagcacaacttagccaactac
ttgttcttcctgatgtatctgattaacaaagacgaaacagagcacacgggtcaggaatct
tatgtctggaagatgtaccaggaaaggtgttgggatttcttcccagctggtgactgcttt
cgaaaacaatacgaagatcagcttggataa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520024
Entry
107520024         CDS       T06036                                 

Gene name
RYR2
Definition
(RefSeq) LOW QUALITY PROTEIN: ryanodine receptor 2
  KO
K04962  ryanodine receptor 2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04024  cAMP signaling pathway
ray04260  Cardiac muscle contraction
ray04261  Adrenergic signaling in cardiomyocytes
ray04371  Apelin signaling pathway
ray04713  Circadian entrainment
ray04911  Insulin secretion
ray04921  Oxytocin signaling pathway
ray04972  Pancreatic secretion
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05410  Hypertrophic cardiomyopathy
ray05412  Arrhythmogenic right ventricular cardiomyopathy
ray05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107520024 (RYR2)
   04020 Calcium signaling pathway
    107520024 (RYR2)
   04024 cAMP signaling pathway
    107520024 (RYR2)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107520024 (RYR2)
   04921 Oxytocin signaling pathway
    107520024 (RYR2)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    107520024 (RYR2)
   04261 Adrenergic signaling in cardiomyocytes
    107520024 (RYR2)
  09154 Digestive system
   04972 Pancreatic secretion
    107520024 (RYR2)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107520024 (RYR2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion disease
    107520024 (RYR2)
   05022 Pathways of neurodegeneration - multiple diseases
    107520024 (RYR2)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    107520024 (RYR2)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    107520024 (RYR2)
   05414 Dilated cardiomyopathy
    107520024 (RYR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ray04040]
    107520024 (RYR2)
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107520024 (RYR2)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107520024 (RYR2)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   107520024 (RYR2)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5
Other DBs
NCBI-GeneID: 107520024
NCBI-ProteinID: XP_016018848
LinkDB
Position
Unknown
AA seq 4942 aa
MAGTLVPESLLASLIREPPAVQRDDEVVLQCTATVHKEQQKLCLAAEGFGNRLCFLESTS
NSKNVPPDLSICTFVLEQSLSVRALQEMLANTMEKSEGKFMMKTAQGGGHRTLLYGHAIL
LRHSCSGMYLCCLSTSRSSTDKLAFDVGLQEDTTGEACWWTIHPASKQRSEGEKVRVGDD
LILVSVSSERYLHLSYGDGSLHVDAAFQQTLWSVAPISSGSEAAQGYLIGGDVLRLLHGH
MDECLTVPSGEHGEEQRRTVHYEGGVVSVHARSLWRLETLRVAWSGSHIRWGQPFRLRHV
TTGKYLSLMEDHNLLLVDKEKADVKSTAFTFRSSKEKLDAGVRKEVDGMGTSEIKYGDSV
CYIQHVNTGLWLTYQSVDVKSVRMGAIQRKAIMHHEGHMDDGINLSRSQHEESRTARVIR
STVFLFNRFIRGLDALGKKAKAPAADLPIESVSLSLRDLTGYLHPPDEQLEHEDRQNRLR
ALKNRQNLFQEEGMISLVLECIDRLHVYSSAAHFADVAGTEAGQAWKSILNSLYELLAAL
IRGNRKNCAQFSGSLDWLISRLERLEASSGILEVLHCVLVESPEALNIIKEGHIKSIISL
LDKHGRNHKVLDVLCSLCVCHGVAVRSNQHLICDNLLPGRDLLLQTRLVNHVSSMRPNIF
LGVSEGSAQYKKWYYELMVDHTEPFVTAEATHLRVGWASTEGFSPYPGGGEEGGGSGVGD
DLFSYGFDGLHLWAGCIARTVSSPNQHLLRTDDVISCCLDLSAPSISFRINGQPVQGMFE
NFNIDGLFFPVVSFSAGIKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPKERLKVEHSREY
KQERAPARDLLGPTVALTQAAFTPVPVDTSQIVLPPHLERIREKLAENIHELWVMNKIEL
GWQYGPVRDDNKRQHPCLVEFSKLPEQERNYNLQMSLETLKTLLALGCHVGIADEHAEEK
VKKMKLPKNYQLTSGYKPAPMDLTFIRLTQAQEAMVDKLAENAHNVWARDRIRQGWTYGI
QQDVKNRRNPRLVPYTLLDDRTKKSNKDSLREAVRTLLGYGYSLEAPDQDHAARAEAAGR
TGERFRIFRAEKTYAVRAGRWYFEFEAVTAGDMRVGWSRPGCQPDQELGSDERAFTFDGL
KAQRWHQGNEHYGRSWQAGDVVGCMVDMTEHTMMFTLNGEILLDDSGSELAFKDFDTGDG
FIPVCSLGVAQVGRMNFGKDVSTLKYFTICGLQEGYEPFAVNTNRDITMWLSKRLPQFLQ
VPSNHEHIEVTRIDGTVDSSPCLKVTQKSFGSQNSSTDITFYRLSMPIECAEVFSRTAAG
GLPGAGLFGPKNDLEDYDADSDFEVLMKTAHGHLVPDRVDKDKEATKAEFNNHKDYAQEK
PSRLKQRFLLRRTKPDYSTSHSARLTEDVLADDRDDYDYLMQTSTYYYSVRIFPGQEPAS
VWVGWITSDFHQYDTGFDLDRVRTVTVTLGDEKGKVHESIKRSNCYMVCAGESMSPGQGR
GNNGLEIGCVVDAATGLLTFTANGKELSTYYQVEPSTKLFPAVFAQATSPNVFQFELGRI
KNVMPLSAGLFKSEHRNPVPQCPPRLHVQFLSHVLWSRMPNQFLKVDVSRVSERQGWLVQ
CAEPLQFMSLHIPEENRSVDILELTEQEELLRFHHHTLRLYSAVCALGNHRVAHALCSHV
DEPQLLYAIESKYMPGLLRAGYYDLLIDIHLSAYATARLRMTKSITLFPDAHKEHGLPGI
GLSTSLRPRMRFSSPSFVXINHDCYQDSPEFPLDTLKAKTMQMLTEAVREGGLRARDPVG
GTTEFLFVPLIKLFYTLLIMGVFHGEDLKHILQLIEPRVFTEATPEAECQARSXADDARP
EGMRGDAAEGLLQMKLPAVRSXMCLLLQYLCDCQVRHRIEAIVAFSDNFVAKLQDNQRFR
YNEVMQALNMSAALTARKTREFRSPPQEQINMLLNFKDDKSECPCPEEIRDQLLDFHEDL
MAHCGIELGEDGSLDGSSDLTIKGRLLSLVEKVTYLKKKQTEKPVERDARKSSTLQQLIS
DTMVRWAQESVIEDPELVRAMFVLLHRQYDGIGGLIRALPKTYTINGVSVEDTINLLASL
GQIRSLLSVRMGKEEEKLMIRGLGDIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGE
SKEITFPKMVANCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPSMRGSTPLDVA
AASVMDNNELALALREPDLEKVVRYLAGCGLQSCQMLVCKGYPDIGWNPVEGERYLDFLR
FAVFCNGESVEENANVVVRLLIRRPECFGPALRGEGGAGLLAAMEEAIRIAEDPSRDGPS
PTSESAKTPDAEEEEDDTIHMGNAIMTFYAALIDLLGRCAPEMHLIHAGKGEAIRIRSIL
RSLIPLGDLVGVISIAFQMPTVAKDGNVVEPDMSAGFCPDHKAAMVLFLDRVYGIEVQDF
LLHLLEVGFLPDLRAAASLDTAALSATDMALALNRYLCTAVLPLLTRCAPLFAGTEHHAS
LIDSLLHTVYRLSKGCSLTKAQRDSIEVCLLSICGQLRPSMMQHLLRRLVFDVPLLNEHA
KMPLKLLTNHYERCWKYYCLPGGWGNFGAASEEELHLSRKLFWGIFDALSQKKYEQELFK
LALPCLSAVAGALPPDYMESNYVSMMEKQSSMDSEGNFNPQPVDTSNITIPEKLEYFINK
YAEHSHDKWSMDKLANGWIYGEIYSDSSKVQPLMKPYKLLSEKEKEIYRWPIKESLKTML
AWGWRVARTREGDSMALYSRTRRISQTSQVSVDAAHGYSPRAIDMSNVTLSRDLHAMAEM
MAENYHNIWAKKKKVELESKGGGNHPLLVPYDTLTAKEKAKDREKAQDILKFLQISGYAV
SRGFKDLELDTPSIEKRFAYSFLQQLIRYVDGAHQYILEFDGGSRGKGEHFPYEQEIKFF
AKVVLPLIDQYFKNHRLYFLSAASRPLCSGGHASNKEKEMVTSLFCKLGVLVRHRISLFG
NDATSIVNCLHILGQTLDARTVMKTGLESVRSALRAFLDSAAEDLEKTLENLRQGQFTHT
RSQPKGVTQIINYTTVALLPMLSSLFEHIGQHQFGEDLILEDVQVSCYRILTSLYALGTS
KSIYVERQRSALGECLAAVAGAFPVAFLETHLDKHNIYSVYNTKSSRERAALNLPASVED
VCPNIPSLEKLMGEIVEVAESGVRYTQMPHVMEVVLPLLCSYLSRWWEHGPESNPARAAT
CCTALSSEHMNTLLGNILKIIYNNLGIDEGAWMKRLAVFSQPIINKVKPQLLKTHFLPLM
EKLKKKAAMVVSEEEHLKAEARGDMSEAELLILDEFTTLARDLYAFYPLLIRFVDYNRAK
WLKEPNPEAEDLFRMVAEVFIYWSKSHNFKREEQNFVVQNEINNMSFLITDTKSKMSKAA
VSDQERKKMKRKGDRYSMQTSLIVAALKRLLPIGLNICAPGDQELIALAKSRLSMKDTEE
EVRDIIRSNIHLQGKLEDPAIRWQMALYKDLPNRTEDSSDPEKTVERVLDIANVLFHLEQ
VEHPQRSKKAVWHKLLSKQRKRAVVACFRMAPLYNLPRHRAVNLFLQGYEKSWIETEEHY
FEDKLIEDLAKPGAEPAEDEDGARRVDPLHQLILLFSRTALTEKCKLEEDFLYMAYADIM
AKSCHDEEEDDGEEEVKSFEVTGSQRSKEKEMEKQKLLYQQARLHDRGAAEMVLQTVSAS
KGETGPMVAATLKLGIAILNGGNATVQQKMLDYLKEKKDVGFFQSLAGLMQSCSVLDLNA
FERQNKAEGLGMVTEEGSGEKVLQDDEFTCDLFRFLQLLCEGHNSDFQNYLRTQTGNNTT
VNIIISTVDYLLRVQESVSDFYWFYSGKDVIDEQGQRNFSKAIQVAKQVFNTLTEYIQGP
CTGNQQSLAHSRLWDAVVGFLHVFAHMQMKLSQDSSQIELLKELMDLQKDMVVMLLSMLE
GNVVNGTIGKQMVDMLVESSNNVEMILKFFDMFLKLKDLTSSDTFKEYDPDGKGIISKRE
FHRVMESHKHYTQSETEFLLSCVETDENETLDYEGFVKRFHEPAKDIGFNVAVLLTNLSE
HMPNDTRLQTFLELAESVLNHFQPFLGRIEVMGSAKRIERVYFEISKSSRMQWEKPQVKE
SKRQFIFDVVNEGGEKEKMELFVNFCEDTIFEMQLAAQISESDSNERSASKEESEAEKPE
EQGPRMAFFSMLTVGAALLALRHNALTLLRMLSLKSLRKQVKKVKKMTVRDMAAALFCSY
WGVSLSLLHFAASVLRGFSRIVCSLLLGGSLVEGAKKIRVAELLANMPDPTQDEVRGDGE
EAERKPLEAALPSEDLTDLKELTEESDLLSDIFGLDLKREGGQYKLIPHNPNAGLSDLMS
NPVPAPEVQDKCQEQKAKEEEKEEKEEKSEPEKAGGENGEKEEKAKEEKGKQKLRPLHTH
RYGEAEAPESAFWKKIIAYQQKLLNYFARNFYNMRMLALFVAFAINFILLFYKVSTSSAV
EGRELPARSPGDSAAVGGLGGLGGGALRATAVHYVLEESSGYMEPALRILAVLHTAISFC
CIIGYYCLKVPLVIFKREKEVARKLEFDGLYITEQPSEDDIKGQWDRLVINTQSFPNNYW
DKFVKRKVMDKYGDFYGRDRISELLGMDKAALDFSDAREKKKPKKDSSLSAVLSSVDVKY
QMWKLGVVFTDNSFLYLAWYMTMSVLGHFNNFFFAAHLLDIAMGFKTLRTILSSVTHNGK
QLVLTVGLLAVVVYLYTVVAFNFFRKFYNKSEDGDTPDMKCDDMLTCYMFHMYVGVRAGG
GIGDEIEDPAGDEYEIYRIIFDITFFFFVIIILLAIIQGLIIDAFGELRDQQEQVKEDME
TKCFICGIGNDYFDTVPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQ
ERCWEFFPAGDCFRKQYEDQLN
NT seq 14829 nt   +upstreamnt  +downstreamnt
atggcaggcaccctggtacctgaatccctgttggcatccctcatcagagagccacctgcc
gtccagcgcgatgacgaggtcgtcctgcagtgcacggccaccgtccacaaggagcagcag
aagctgtgtctggcggcggagggcttcggcaacaggctctgtttcttggagtccacttca
aattccaagaatgtacccccagacctctccatctgcacctttgtgctggaacagtctctc
tccgtccgggccctgcaagagatgctggcaaacacgatggagaagtcagaagggaaattc
atgatgaagactgctcagggcggcggccaccggacgctcctctacggacacgccattctg
ctgcgccattcctgcagcggcatgtatctgtgttgcctgtccacctcccggtcttccacg
gataaactggccttcgatgttggcttgcaagaagacacgacaggtgaggcctgttggtgg
accatccacccggcctcgaagcagcggtcggaaggggagaaagttcgagtgggagatgac
ctcatcttggtgagcgtgtcctccgaaaggtacttgcacctgtcctacggtgacggcagc
ttgcacgtggacgcagctttccagcagaccctgtggagcgtggcccccatcagctcaggg
agcgaagcagcccaagggtatctgatcggtggcgacgtcctcaggttgctgcacggacac
atggacgaatgcctcactgtcccttcgggagagcacggggaggagcagcggaggaccgtc
cattatgaaggtggcgttgtgtctgttcacgcgcggtccctgtggagactggagacgcta
agggtggcgtggagtggaagccacatccggtggggccagcctttccgactccgccatgtc
acgaccgggaaatacttgagtctcatggaggaccacaaccttctgctcgtggacaaagaa
aaagcagacgtgaaatcgacagcgtttaccttccggtcttccaaggaaaaattggatgca
ggggtgagaaaagaagtcgatggcatgggaacatccgagataaagtatggagactcagtg
tgctacatacaacacgtgaacacaggcctgtggctgacgtaccagtctgtggacgtgaaa
tctgtgaggatgggagccatacagcgtaaggctattatgcaccatgaaggccacatggat
gatggcataaatttatctagatctcagcatgaagaatcgcggacagcgcgagtcatccgg
agcaccgtcttcctttttaatagatttataaggggcctcgacgctcttggcaaaaaggcg
aaggcgcccgcagcggacttgcccatcgagtcggtcagcctgagtctgcgggacctgacg
ggctacctgcacccgcccgacgagcagctggagcacgaggaccggcagaaccggctgcgg
gccctgaagaaccggcagaacctcttccaggaggaggggatgatcagtctcgtgctcgag
tgcatagaccggctgcatgtctacagcagcgccgcccacttcgctgacgtggccgggaca
gaagccgggcaggcctggaagtcgatcctgaactctctgtatgagttgctggcggctcta
attagaggaaatcgtaaaaactgcgctcagttttctggctccctcgactggctgatcagc
cgattggaaaggctggaagcgtcttctggtattctcgaagttttgcactgtgtgttagta
gaaagtccagaagctctaaacattattaaagaaggacatattaaatccattatttcactt
ttagacaagcacggaagaaatcacaaggtcctggacgtcttgtgctctctctgcgtctgc
cacggagtggctgtccgctccaaccagcacctcatctgtgacaatctcctgccgggaaga
gatctcttgctgcagacccgcctcgtgaaccacgtcagcagcatgaggcccaatattttt
ctgggcgtgagcgaagggtctgcccagtataagaagtggtactacgaactgatggtggac
cacaccgagccgttcgtgacagccgaagcgactcacctgcgcgtgggctgggcgtccacg
gagggcttctcgccctaccccggaggcggcgaggaggggggcggcagcggcgtgggcgac
gacctcttctcctacgggttcgacggcctgcacctctgggcaggttgtattgctcggact
gtaagctcaccgaaccaacatctgttgagaactgatgatgtcatcagttgctgtttagac
ctaagtgccccgagcatctccttccgaattaacggacaacctgttcaaggcatgtttgag
aatttcaacatcgatggcctcttctttcctgttgttagtttctctgcgggaataaaggtg
cgctttctgcttggggggcgacatggagaattcaagttcctgcccccgccgggctacgct
ccgtgtcacgaagctgtcctgccgaaggagaggctgaaggtggagcacagccgcgagtac
aagcaggagagggcgcccgcgagggacctgctgggccccacagtggcgctgacgcaagcc
gccttcacgccggttcccgtggacaccagccagatcgtgttgccaccccacctggagagg
ataagagaaaaattggcagagaatatccatgagctctgggttatgaataagattgaactt
ggctggcagtatgggccggtgcgcgatgacaacaagaggcagcacccgtgtctggtggag
ttctccaagctgcccgagcaggagcgcaattacaacttacagatgtccctggagaccctg
aagactctgctggcattaggatgccacgtgggcatcgcagacgagcatgctgaagaaaag
gtgaagaagatgaagctgcccaagaactaccagctgacgagtggatacaaacctgccccg
atggacttgacctttatcagactcacccaggcccaggaggcaatggtggacaagttggcg
gaaaacgcccataacgtgtgggcccgggatcggatccggcagggctggacctacggcatc
cagcaggatgtaaagaacagaagaaaccctcgcctcgttccctacacacttctcgatgac
agaaccaagaaatccaataaggacagcctccgtgaggctgtgcgcacgctgctggggtac
ggctacagcctggaggcgccggatcaggatcacgctgcgcgcgccgaggcggccggccgc
accggggagaggttccgcatcttccgggccgagaagacgtacgcggtgcgggccgggcgg
tggtatttcgagttcgaggctgtcaccgccggggacatgcgtgttggctggagcaggccg
ggctgtcagccggaccaggagctgggctcggacgagcgcgccttcaccttcgatggcctc
aaggcccagcgatggcaccagggcaatgagcactatggccgctcttggcaagccggcgat
gttgtagggtgtatggttgacatgacagagcacaccatgatgttcacgctgaacggtgaa
atcctccttgatgattcgggctcagaactggcgttcaaggactttgacaccggcgatgga
ttcatacctgtgtgcagccttggggtggctcaagtgggcaggatgaacttcggaaaggac
gtgagcaccttgaaatatttcaccatctgtggcttacaggagggctacgaaccatttgcc
gttaacacaaacagggacattaccatgtggctgagcaagcggctgcctcagtttctccaa
gttccatcaaatcatgaacatattgaggtgaccaggatagacggcaccgtagacagttcc
ccgtgcttaaaggtcacgcagaagtcctttggttctcagaacagcagcacggacatcacg
ttttaccgcctgagcatgcccatcgagtgcgccgaggtcttctccaggacggcggctggg
gggctgcctggggccggcctctttgggcccaagaacgatctggaggattacgatgcggac
tctgacttcgaggttctgatgaagacagctcacggccacctggtgcccgatcgagtcgac
aaagacaaagaagctacgaaagcagagtttaataaccacaaagattacgcccaggagaag
ccctctcgcctgaaacagagatttttgctgagaagaacgaaaccagattacagcacaagc
cattctgcgaggctcacagaagacgtgctcgcggatgatcgggatgattacgactacctg
atgcagacgtccacgtactattattctgtgagaatcttccctggacaagagccggccagc
gtctgggtgggctggatcacgtccgacttccaccagtatgacacgggcttcgacttggac
agagttcgcacagtaaccgttactctgggcgacgaaaaaggaaaagtgcacgaaagcatc
aaacgcagcaactgctacatggtgtgtgcaggcgagagcatgagccctgggcaaggacgc
ggcaacaatgggctggagatcggctgcgtggtggacgcagccactgggctgctcacgttc
acggccaatggcaaggagctgagcacgtactaccaggtggagccgagtaccaaattattc
cctgcagtttttgcacaagctacaagtcccaatgtttttcagtttgagttgggaagaatt
aagaacgtgatgccgctgtctgccgggctgttcaagagtgagcacaggaaccccgtgccg
cagtgcccgccgcgcctgcacgtgcagttcctgtcgcacgtcctctggagccggatgccc
aaccagttcctgaaggtggacgtgtcgcgggtcagcgagcgccagggctggctggtgcag
tgcgcggagcccctgcagttcatgtcgctgcacatcccggaggagaacaggtccgtggac
atcctggagctgacggagcaggaggagctgctgcgcttccaccaccacacgctgcggctc
tactcggccgtgtgcgcgctgggcaaccaccgcgtagcgcacgcgctctgcagccacgtg
gacgagccgcagctgctctacgccatcgagagcaagtacatgcccggcctgctgcgcgcc
ggctactacgacctgctcatcgacatccacctgagcgcctacgccaccgcgcggctgcgg
atgaccaagagcatcacgctcttcccggatgcgcacaaggagcacgggctgccgggcatc
ggcctcagcacctcgctgcgcccgcgcatgcgcttctcctcgcccagctttgtgnncatc
aatcacgactgctaccaggacagccccgagttcccgctggacacgctcaaggccaagacc
atgcagatgctgaccgaggcggtgcgagagggcggcctgcgcgcgcgggacccggtcggg
ggcaccaccgagttcctcttcgtgccgctcatcaagctcttctacacgctgctcatcatg
ggcgtcttccacggcgaggacctgaagcacatcctgcagctgattgagccccgggtcttc
acggaggccaccccggaggcggagtgccaggcgcggtccnnggccgacgacgccaggccc
gagggcatgcgtggggacgcggcggagggtctgctgcagatgaagctgccggccgtgaga
agctgaatgtgcctgctgctccagtacctctgtgactgccaggtccggcaccggatagaa
gccatcgtggccttttcggataactttgtagctaagctccaagacaaccagcgcttccgc
tacaatgaagtcatgcaagccctgaacatgtcggctgcactcacagccaggaagacgagg
gaatttcggtcaccacctcaagaacagatcaatatgcttctcaattttaaggatgacaaa
agtgaatgtccgtgtcctgaagaaatccgggaccaactcttggattttcacgaagatcta
atggcacattgtggaattgagctgggtgaggacgggtctctggatggaagcagcgatctg
acaattaaaggccgcctgctgtccctggtagaaaaggtgacatacctgaagaagaaacaa
actgaaaagccagttgagcgtgacgccaggaagtcatccacccttcagcagctgatctcg
gacaccatggttcggtgggctcaggagtccgtcattgaagacccggagctggtgagggcc
atgttcgtgctgctgcatcgacagtacgatggcatcgggggtctgatccgggccctgcca
aaaacctacactataaacggtgtttccgtggaggacaccatcaacctgctggcctctctc
ggtcagatccgttctctgctgagtgtgaggatgggcaaagaagaagagaagcttatgatc
cgtggattaggggatatcatgaataacaaagtgttttaccagcaccctaatctcatgagg
gcactgggcatgcacgagacagtgatggaggtcatggtgaatgtcctcggaggcggggag
tccaaggagatcacttttcccaagatggtggccaactgttgccgttttctttgttatttc
tgtcggataagccggcagaatcaaaaagccatgtttgaccatctcagttatttattggaa
aacagtagtgttggtctcgcctcgccatctatgagaggttcaacaccgctggatgtggct
gcagcctcggtgatggataacaatgaactggccttagctttgcgtgagcccgacctggaa
aaggtcgttcggtatctggctggctgtggactgcagagttgccagatgctggtgtgtaag
gggtacccagacattggctggaacccagtggaaggggagcggtacctcgacttcctcaga
tttgctgtcttctgtaatggggagagtgtggaggagaacgccaacgtcgtggtgaggctg
ctcatccggcggcctgagtgcttcggcccggctctgcgaggggagggcggggccgggctt
ctcgccgccatggaggaagccatccggatagcggaggacccttctcgagacggaccctcg
ccaaccagcgaatccgcgaaaacccctgacgcggaggaggaggaggacgacactatccac
atggggaacgccatcatgaccttttacgcagctctgatcgacctgctgggacgctgcgct
cccgagatgcacttgattcatgctggtaagggagaagccatcaggatcagatctattttg
agatctctgattcccctgggagatttggtgggcgtaatcagcatcgccttccagatgcca
acagtagccaaggatgggaatgtggtggagcctgacatgtctgcggggttttgcccagat
cacaaggcagccatggttttgttccttgacagggtctatgggattgaggttcaggatttc
ctcctgcatctgctagaggttggctttctgccagatctccgagctgctgcttctttagac
acggccgcgttgagtgccacggacatggccttggccctgaatcggtacttgtgcacggcc
gtgctgcctctgctgacgagatgtgcccctctttttgccggcacagagcaccatgcgtcc
ctcatcgactcgttacttcacaccgtgtacaggctttctaagggctgctcgctgaccaaa
gcccagcgggattccatagaagtttgtctgctctctatttgtggccaactgagaccttct
atgatgcagcacttactcagaagattagtatttgatgtcccgttattaaatgaacatgca
aagatgccactgaagctgctgacaaatcattatgaaaggtgctggaaatattactgcctg
cctggagggtggggaaactttggagctgcctcagaagaagaacttcatttatcaagaaag
ttgttctggggcattttcgatgccctgtctcaaaagaaatatgaacaagaacttttcaaa
ctggcactgccgtgtctgagcgcagttgcaggagctttgcctccagactacatggagtcc
aattatgtcagcatgatggaaaaacagtcgtcaatggattctgaagggaactttaaccca
cagcctgttgatacctcaaatattacaattcctgagaagctggagtactttattaacaag
tacgcggaacactcccacgacaagtggtccatggacaagttggcaaatggatggatttat
ggagaaatatattcagactcatctaaagttcagccattaatgaagccatataagttatta
tctgaaaaggaaaaagaaatctatcgctggcccatcaaggagtccctgaagacgatgctg
gcgtggggctggagggtggcgcgcacgcgcgagggcgacagcatggcgctgtacagccgc
acgcgccgcatctcgcagaccagccaggtctctgtggatgctgcccacggttacagtccc
cgggccatcgacatgagcaacgtcacgctgtctagagatctgcatgcgatggcagaaatg
atggctgaaaactaccataacatatgggcaaagaaaaagaaagtggaactggaatccaaa
ggaggtggaaaccatcccctgctcgtgccctacgacacactgacagccaaagagaaagcc
aaggacagggaaaaagcccaagacatcctcaagttcctgcagatcagtggatacgctgtg
tccagaggattcaaggacctggaactggacacgccttccattgagaagcgatttgcctac
agcttcctgcagcagctcatccgctacgtggacggtgcccatcagtacatcctggagttc
gatgggggcagcagaggcaaaggagagcatttcccctacgagcaagaaatcaagttcttc
gccaaagtcgttcttcctttaatcgatcagtatttcaaaaaccatcgcctgtacttcctg
tctgcggccagcagacctctctgctccggaggacacgcctcgaacaaggagaaggaaatg
gtgacaagcctattctgcaaacttggagttcttgtcaggcataggatttcactgtttgga
aatgatgcgacatcgattgtcaactgtcttcatattttgggtcagactttggatgcgagg
acggtcatgaagacgggcctggagagcgtcagaagcgcgctcagagcgtttctggacagc
gccgcggaggacctggagaagaccctggagaacctccggcagggccagttcacccacacc
cggagccagcccaagggcgtcacgcagatcatcaactacaccacggtggccctgctgccc
atgctgtcgtcgctgttcgagcacatcggccagcatcagttcggagaagatttaatcctg
gaagatgtacaggtgtcatgttacagaattctgaccagcttatatgctttgggaacgagc
aagagcatttatgtggaaaggcaacgttctgcattaggagaatgtctggctgccgttgct
ggtgcctttcctgtggcgtttttggaaacgcatctcgacaaacataatatttactctgtc
tacaatactaagtcctcacgagagcgagcagctctcaacctgccggccagcgtggaagac
gtctgtccgaacatcccgtccttggagaagctcatgggcgagatcgtggaggtggccgag
tccggcgtccgctacacgcagatgccgcacgtgatggaggtcgtcctgcccctgctgtgc
agctacctgtctcgctggtgggagcacggccccgagagcaacccggcccgggccgcgacg
tgctgcacggcgctcagctccgagcacatgaacaccctgctgggcaacatcctgaagatc
atctacaacaacctgggcatcgacgagggcgcctggatgaagaggttggcagtattttcc
cagcctattataaacaaagtgaaacctcagctcttgaaaactcatttcttgccactgatg
gagaaactcaagaaaaaggccgcgatggtggtgtctgaagaagagcatctgaaagccgag
gccaggggggacatgtccgaggccgagctgctcatcctggacgagttcaccacgctggcc
cgagacctctatgccttctacccgctcttgattagattcgtggactataacagggcgaag
tggctcaaagagccaaacccagaagccgaggaccttttccgcatggtggccgaagtcttc
atctactggtcgaaatcccataatttcaaaagagaagagcagaacttcgtcgtacagaat
gaaatcaacaacatgtctttcctcattacagacaccaagtcaaagatgtcaaaggcggcg
gtgtctgaccaggagcggaagaagatgaagcgcaagggagaccgctactccatgcagaca
tccctcatcgtggcggctctgaagcggctgctgcccatcggcctcaacatctgcgctccg
ggcgaccaggagctcatcgcgctggccaagagccggctcagcatgaaagacactgaggaa
gaagtacgcgacatcatccgcagtaacattcacttacagggcaagttggaggaccctgcc
atcagatggcagatggctctttacaaagacttgccgaacaggactgaagacagttcggat
cccgagaagacagtagaaagagtgctggacatagcaaatgtgcttttccatcttgaacag
gtggagcatccgcagaggtccaaaaaggccgtctggcacaagctgctctccaagcagagg
aagagggccgtggtggcctgcttccgcatggctccgttgtataacctgccaaggcatcgg
gctgttaatctctttcttcagggatatgaaaagtcctggattgaaacagaagaacattac
tttgaagataaactgatagaagatttagcaaagcctggagcggagcccgcagaggacgag
gacggcgccaggagagtcgaccctctgcaccagctgatcctgctgtttagccggacggcc
ctgacggagaaatgcaaactggaggaagattttttatacatggcttatgcagatattatg
gcaaagagttgtcatgacgaggaagaagatgatggtgaggaagaagtgaagagttttgaa
gtcacaggatcgcagcgcagcaaggaaaaagaaatggaaaagcaaaagcttctgtaccag
caagcccggctgcacgaccgcggtgccgcggagatggtgctgcagacggtcagcgccagc
aaaggggagaccgggccgatggtcgccgccacgctgaagctcggcatcgccatcctgaac
ggcgggaacgccacggtgcagcagaaaatgctcgactacctcaaggagaagaaggacgtc
ggcttcttccagagcctggccggcctcatgcagtcctgcagtgtcctcgacctcaatgcc
tttgagcgacaaaacaaagctgaaggactcggaatggtgacagaggaaggatcaggagaa
aaggtcctgcaggatgatgagttcacctgtgacctgttccgcttcctgcagctgctttgt
gaggggcacaactcagattttcagaattacctgagaacgcagaccggcaacaacaccact
gtcaacatcatcatctccaccgtcgactacctgctgcgggtccaggagtcggtcagcgat
ttctactggttctactccgggaaagacgtcatcgacgagcaaggacagaggaatttctcc
aaagcgattcaggtcgccaagcaggtgttcaacacactcacggagtacattcagggcccg
tgcactggcaaccagcagagcctggcgcacagccggctgtgggacgcggtggtgggcttc
ctgcacgtgttcgcgcacatgcagatgaagctgtcccaggattccagtcagatcgagctg
ctgaaggagctgatggacctgcagaaggacatggtggtgatgctgctgtccatgctggaa
ggtaacgtcgtgaacgggaccatcggcaagcagatggtcgacatgctggtggagtcgtcc
aacaacgtggagatgattctgaaattcttcgacatgttcttaaaactgaaggacttgaca
tcttctgacacatttaaggaatacgaccccgatggcaagggcatcatttccaagagggag
ttccacagagtgatggagagccacaagcactacacgcagtccgagactgagttcctcctg
tcctgcgtggagacggacgagaacgagaccctcgactacgaggggttcgtcaagcgtttc
catgagcccgcgaaggacatcggcttcaacgtcgccgtgctcctgacgaacctctccgag
cacatgcccaacgacacgcggctgcagaccttcctggagctagccgagagcgtgctcaac
cacttccagcccttcctaggccgcatcgaggtcatgggcagcgccaagcgcatcgagagg
gtttacttcgaaatcagcaagtccagccggatgcagtgggagaagccgcaggtcaaggag
tccaagaggcagttcatcttcgatgtggtcaacgagggcggtgagaaggagaagatggag
ctcttcgtgaacttctgcgaggacaccatcttcgagatgcagctggcggcccagatctcg
gagtcggactcgaacgagcgctcggccagcaaggaggagagcgaggcggagaagccggag
gagcaggggccgcgcatggccttcttctccatgctgaccgtcggggccgccctgctcgcg
ctcaggcacaacgcgctgaccctcctgcggatgctcagcctgaagagcctgcggaaacag
gtgaagaaggtgaagaagatgacggtgcgagatatggccgccgccctcttctgctcctac
tggggtgtgtcgctgagcctgctgcacttcgcggccagcgtgctcagaggcttctcccgc
atcgtctgcagcctgctgctgggaggcagcctcgtggagggcgccaagaagatcagagtg
gctgagcttttggccaacatgccggaccccacgcaggatgaggtgcggggagacggcgag
gaggccgagaggaagccactggaagccgccctgccctccgaggacctcacggatctgaag
gagctgacggaggaaagtgacctcctctcggacatatttggcctggatctgaagagagaa
ggaggacagtacaagctcatccctcataacccgaacgccggcctcagcgacctcatgagc
aaccctgtccccgcccccgaggtgcaagacaagtgtcaggaacagaaggcaaaagaggaa
gaaaaggaagaaaaggaagaaaaatcggagcctgaaaaagccgggggagaaaatggggaa
aaagaagaaaaagccaaggaagagaaaggcaaacagaagctccggccgctgcacacacac
agatacggagaggccgaggcccccgagtcagcgttctggaagaaaatcatagcttatcaa
cagaagctgctaaactattttgctcgcaacttttacaacatgagaatgttagccttattt
gtcgcatttgcaatcaatttcatcttgctcttctacaaggtctccacttcttcggcggtt
gaaggaagggagctccccgcccgcagccctggggacagcgccgcggtgggcggcctgggc
ggcctgggcggcggggcgctgcgcgccacggccgtgcactacgtcctggaggagagcagc
ggctacatggagcccgccctgcgcatcctggccgtgctgcacaccgccatctccttctgc
tgcatcatcggctactactgcctgaaggttccactggttattttcaagcgagagaaggaa
gtagctcgaaaattagaatttgatggactttatattacagaacagccttcagaagatgat
attaaagggcagtgggatagacttgtgatcaacacacagtcatttcccaacaactactgg
gacaaatttgttaaaagaaaggtcatggacaagtacggggacttctacggccgggacagg
atcagcgagctgctcggcatggacaaggccgctctggacttcagcgacgcccgggagaag
aagaagcccaagaaagacagctccctgtcggctgtgctgagctctgtggacgtgaagtac
cagatgtggaagctcggggtcgtcttcaccgacaactccttcctctaccttgcctggtac
atgaccatgtctgttctcggacactttaacaactttttttttgctgctcatcttcttgac
atcgctatggggttcaagacgctgagaaccatcttgtcgtccgtaactcacaatggcaaa
cagctggtattaaccgtgggcttgttagctgtggtcgtgtacctgtatactgttgtggca
ttcaattttttccgaaaattctacaataagagtgaagatggagatacgccagacatgaaa
tgtgacgacatgctaacatgctacatgttccacatgtatgtcggggtccgtgctggcggg
ggcatcggcgatgagatcgaggaccccgcgggcgacgagtacgagatctaccgcatcatc
ttcgacatcaccttcttcttcttcgtcatcatcattctcttggccataatacaaggttta
attattgatgcttttggagaactcagagaccagcaggagcaagtcaaagaggacatggag
accaaatgcttcatctgtggcataggcaacgattacttcgacacggtgccgcacggcttc
gaaacgcacaccttgcaggagcacaacttggccaattacctgtttttcctgatgtatctc
ataaacaaggacgaaaccgagcacacagggcaggagtcttatgtctggaagatgtatcaa
gaaagatgctgggagttcttcccagcaggggactgtttccggaaacagtatgaagaccag
ctcaactaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107520956
Entry
107520956         CDS       T06036                                 

Gene name
RYR1
Definition
(RefSeq) LOW QUALITY PROTEIN: ryanodine receptor 1
  KO
K04961  ryanodine receptor 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04020  Calcium signaling pathway
ray04371  Apelin signaling pathway
ray04713  Circadian entrainment
ray04730  Long-term depression
ray04921  Oxytocin signaling pathway
ray05017  Spinocerebellar ataxia
ray05020  Prion disease
ray05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107520956 (RYR1)
   04020 Calcium signaling pathway
    107520956 (RYR1)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    107520956 (RYR1)
  09156 Nervous system
   04730 Long-term depression
    107520956 (RYR1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    107520956 (RYR1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    107520956 (RYR1)
   05020 Prion disease
    107520956 (RYR1)
   05022 Pathways of neurodegeneration - multiple diseases
    107520956 (RYR1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ray01009]
    107520956 (RYR1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107520956 (RYR1)
   04040 Ion channels [BR:ray04040]
    107520956 (RYR1)
Protein phosphatases and associated proteins [BR:ray01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     107520956 (RYR1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   107520956 (RYR1)
Ion channels [BR:ray04040]
 Voltage-gated cation channels
  Ryanodine receptor
   107520956 (RYR1)
SSDB
Motif
Pfam: RYDR_ITPR RyR RR_TM4-6 SPRY Ins145_P3_rec MIR RIH_assoc Ion_trans EF-hand_7
Other DBs
NCBI-GeneID: 107520956
NCBI-ProteinID: XP_016020738
LinkDB
Position
Unknown
AA seq 5027 aa
MGDGGEGEDEVQFLRTDDEVVLQCSATVLKEQLKLCLAAEGFGNRLCFLEPTSNAQNVPP
DLAICCFVLEQSLSVRALQEMLANTVEAGVESSQGGGHRTLLYGHAILLRHAHSGMYLSC
LTTSRSMTDKLAFDVGLQEDATGEACWWTMHPASKQRSEGEKVRVGDDLILVSVSSERYL
HLSTASGELQVDASFMQTLWNMNPISSGCEEGYVTGGHVLRLFHGHMDECLTISSADSDD
QRRLVHYEGGAVCTHALPLRISWSGSHLRWGQPLRIRHVTTGRYLALTEDQGLVVVDASK
AHTKATSFCFRISKEKLDMAPKRDVEGMGPPEIKYGESLCFVQHVASGLWLTYAAPDPKA
LRLGVLKRKAMLHQEGHMDDALSLTRCQQEESQAARMIYSTAGLYNQFIKGLDSFSGKPR
GSGPPAGTALPIEGVILSLQDLIGYFEPPSEELQHEEKQSKLRSLRNRQSLFQEEGMLSL
VLNCIDRLNVYTTAAHFAEFAGEEAAESWKEIVNLLYELLASLIRGNRTNCALFSTNLDW
LVSKLDRLEASSGILEVLYCVLIESPEVLNIIQENHIKSIISLLDKHGRNHKVLDVLCSL
CVCNGVAVRSNQDLITENLLPGRELLLQTNLINYVTSIRPNIFVGRAEGTTQYSKWYFEV
MVDEVAPFLTAQATHLRVGWALTEGYSPYPGGGEGWGGNGVGDDLYSYGFDGLHLWTGHV
ARLVTSPGQHLLAPEDVVSCCLDLSVPSISFRINGCPVQGVFEAFNLDGLFFPVVSFSAG
VKVRFLLGGRHGEFKFLPPPGYAPCHEAVLPRDRLHLEPIKEYRREGPRGPHLVGPSRCL
SHTDFVPCPVDTVQIVLPPHLERIREKLAENIHELWALTRIEQGWTYGPVRDDNKRLHPC
LVNFHSLPEPERNYNLQMSGETLKTLLALGCHVGMADEKAEDNLKKTKLPKTYMMSNGYK
PAPLDLSHVRLTPAQTTLVDRLAENGHNVWARDRVAQGWSYSAVQDIPARRNPRLVPYRL
LDEATKRSNRDSLCQAVRTLLGYGYNIEPPDQEPSLVESQSRWDRVRIFRAEKSYVVQSG
RWYFEFEAVTTGEMRVGWARPELRPDVELGADELAYVFNGHRGQRWHLGSEPFGRPWQSG
DVVGCMIDLTENTIIFTLNGEILMSDSGSETAFRDIEIGDGFLPVCSLGPGQVGHLNLGQ
DVSSLRFFAICGLQEGFEPFAINMQRPVTTWFSKSLPQFEAVPLEHPHYEVARVDGTVDT
PPCLRLSHRTWGSQNSLVEMLFLRLSLPVQFHQHFRCTAGATPLASPGLQPPAEDEARAA
EPDTDYENLRRSAGRWGETEGGKEGTAKEGLPGGTSQAGVEAQPVRAENEKDATTEKNKK
RGFLFKAKKAAMMTQTPATPALPRLPREVVPADDRDDPEIILNTTTYYYSVRVFAGQEPS
CVWVGWVTPDYHQHDMNFDLSKVRAVTVTMGDEQGNIHSSLKCSNCYMVWGGDFVSSGQQ
GRISHTDLVIGCLVDLATGLMTFTANGKESNTFFQVEPNTKLFPAVFVLPTHQNVIQFEL
GKQKNIMPLSAAMFLSERKNPAPQCPPRLEVQMLMPISWSRMPNRFLQVETQRAGERLGW
AVQCQEPLIMMALHIPEENRCMDILELSERLNLQRFHSHTLRLYRAVCALGNNRVAHALC
SHVDQAQLLHALEDAHLPGPLRAGYYDLLISIHLESACRSRRSMLSEYIVPLTPETRAIT
LFPSAKSTDNGPRRHGLPGVGVTTSLRPPHHFSPPCFVVALPVAGVAEAPARLSPSIPLE
ALRDKALRMLGEAVRDGGQHARDPVGGSVEFQFVPVLKLVSTLLVMGIFGDEDVKQILKM
IEPEVFTEEEEEEEEEEEEEEDEEEKEEDEEEEAQEKEDEEKEEEETAEGEKEESLEEGL
LQMKLPESVKLQMCHLLEYFCDQELQHRVESLAAFAERYVDRLQGNQRDRYNLLMKAFTM
SAAETARRTREFRSPPQEQINMLVHFKDGEEVEDCPLPEEIRQDLLEFHQDLLAHCGIQL
EGEEEEPEEEATLGSRLMSLLEKVRLVKKKEKKPEEELPAEESKPESLQELVSHTVVRWA
QEDFVQSPELVRAMFSLLHRQYDGLGELLRALPRAYTISPSSMEDTMSLLECLGQIRSLL
IVQMGPQEENLMIQSIGNIMNNKVFYQHPNLMRALGMHETVMEVMVNVLGGGESKEIRFP
KMVTSCCRFLCYFCRISRQNQRSMFDHLSYLLENSSIGLGMQGSTPLDVAAASVIDNNEL
ALALQEQDLEKVVSYLAGCGLQSCPMLLAKGYPDIGWNPCGGERYLDFLRFAVFVNGESV
EENANVVVRLLIRKPECFGPALRGEGGSGLLAAIEEAIRISEDPARDGPGVRRDRRREHF
GEEPPEENRVHLGHAIMSFYAALIDLLGRCAPEMHLIQAGKGEALRIRAILRSLVPLDDL
VGIISLPLQIPTLGKDGALVQPKMSASFVPDHKASMVLFLDRVYGIENQEFLLHVLDVGF
LPDMRAAASLDTATFSTTEMALALNRYLCLAVLPLITKCAPLFAGTEHRAIMVDSMLHTV
YRLSRGRSLTKAQRDVIEDCLMALCRYIRPSMLQHLLRRLVFDVPILNEFAKMPLKLLTN
HYERCWKYYCLPTGWANFGITSEEELHLTRKLFWGIFDSLAHKKYDSELYRMAMPCLCAI
AGALPPDYVDASYSSKAEKKATVDAEGNFDPRPVETLNVIIPEKLDSFINKFAEYTHEKW
AFDKIQNNWSYGENIDEDLKTHPMLRPYKTFSEKDKEIYRWPIKESLKAMIAWEWTIEKA
REGEEEKVEKKKTRKISQSAQTYDPREGYNPQPPDLSGVTLSRELQAMAEQLAENYHNTW
GRKKKQELETKGGGTHPLLVPYDTLTAKEKARDREKAQELLKFLQMNGYAVTRGLKDMEL
DTSSIEKRFAFGFLQQLLRWMDISQEFIAHLEAVVSSGRVEKSPHEQEIKFFAKILLPLI
NQYFTNHCLYFLSTPAKVLGSGGHASNKEKEMITSLFCKLAALVRHRVSLFGTDAPAVVN
CLHILARSLDARTVMKSGPEIVKAGLRSFFESASEDIEKMVENLRLGKVSQARTQVKGVG
QNLTYTTVALLPVLTTLFQHIAQHQFGDDVILDDVQVSCYRTLCSIYSLGTTRNSYVEKL
RPALGECLARLAAAMPVAFLEPQLNEYNACSVYTTKSPRERAILGLPNSVEEMCPDIPVL
ERLMADIGGLAESGARYTEMPHVIEITLPMLCSYLPRWWERGPEMPPPALPAGAPPPCTA
VTSDHLNSLLGNILRIIVNNLGIDEASWMKRLAVFAQPIVSRARPELLHSHFIPTIGRLC
KRAGKVVAEEEQLRLEAKAEAEEGELLVRDEFSVLCRDLYALYPLLIRYVDNNRAHWLTE
PDPSAEELFRMVGEIFIYWSKSHNFKREEQNFVVQNEINNMSFLTADNKSKMAKAGDVQS
GGSDQERTKKKRRGDRYSVQTSLIVATLKKMLPIGLNMCAPTDQDLITLAKTRYALKDTD
EEVREFLQNNLHLQGKVEGSPSLRWQMALYRGLPGREEDADDPEKIVRRVQEVSAVLYHL
EQVEHPYKSKKAVWHKLLSKQRRRAVVACFRMTPLYNLPTHRACNMFLESYKATWILTED
HSFEDRMIDDLSKAGEQEEEEEEVEEKKPDPLHQLVLHFSRTALTEKSKLDEDFLYMAYA
DIMAKSCHLEEGAENSEAEEEAEVSFEEKEMEKQRLLYQQARLHNRGAAEMVLQMISACK
GETGAMVSSTLKLGISILNGGNADVQQKMLDYLKDKKEVGFFQSIQALMQTCSVLDLNAF
ERQNKAEGLGMVNEDGTVINRQNGEKVMADDEFTQDLFRFLQLLCEGHNNDFQNYLRTQT
GNTTTINIIICTVDYLLRLQESISDFYWYYSGKDVIEEQGKRNFSKAMSVAKQVFNSLTE
YIQGPCTGNQQSLAHSRLWDAVVGFLHVFAHMMMKLAQDSSQIELLKELLDLQKDMVVML
LSLLEGNVVNGMIARQMVDMLVESSSNVEMILKFFDMFLKLKDIVGSEAFQDYVTDPRGL
ISKKDFQKAMDSQKQFTGPEIQFLLSCSEADENEMINCEEFANRFQEPAREIGFNVAVLL
TNLSEHVPHDPRLRNFLELAESILEYFRPYLGRIEIMGASRRIERIYFEISETNRAQWEM
PQVKESKRQFIFDVVNEGGESEKMELFVSFCEDTIFEMQIAAQISEPEGEPEEDDDEGAA
EAGAEGAEDGAAGPEGAAGPAGCGRAARVAAAGGSGPARASATAAARRVRPAARLTARGA
AGGARAPLGGGGAAGAARGRGGALRLLWGSLFGGGLVEGAKKVTVTELLAGMPDPTGDEV
HGEQPSGPGSDADGEGEGEGAGDASEGAGDEEAAAHEAGPGGADRAVAVADGGPFRPDGA
PGGLGDMGDTTPAEPPTPEGSPILKRKLGVDGEEEEVPPEPEPEPEPEKTDAENGEKEDV
PEPAPEPPKKTAPPPPPPKKEEAGGGGLEFWGELEVQRVKFLNYLSRNFYTLRFLALFLA
FAINFILLFYKVSDSPPGEDDMEGSAAGDLAGAGSGGGSGWGSGVGEEAEDDEDENMVYY
FLEESTGYMEPALRCLSLLHTLVAFLCIIGYNCLKVPLVIFKREKELARKLEFDGLYITE
QPEDDDVKGQWNRLVLNTPSFPSNYWDKFVKRKVLDKHGDIFGRERIAELLGMDLATLEI
TAHNERKPEPPPGLLTWLMSIDVKYQIWKFGVIFTDNSFLYLGWYMVMSLLGHYNNFFFA
AHLLDIAMGVKTLRTILSSVTHNGKQLVMTVGLLAVVVYLYTVVAFNFFRKFYNKSEDED
EPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIEDPAGDEYELYRVVFDITFFFFVIIILLA
IIQGLIIDAFGELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMF
FLMYLINKDKTEYTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS
NT seq 15084 nt   +upstreamnt  +downstreamnt
atgggtgacggaggagagggtgaggatgaggtgcagttcctgagaacggacgacgaagtg
gtcctgcagtgcagcgccacggtgctcaaggagcagctcaaactctgcctggccgccgag
ggcttcggcaaccgcctctgcttcctggagcccaccagcaatgcccagaatgtgcccccc
gatctggccatctgctgcttcgtcttggagcaatccctgtctgtccgagccctgcaggag
atgctggccaacactgtggaggccggcgtggagtcgtcccagggtgggggacacaggaca
ctcctgtatggccatgccatcctgctccggcacgcacacagcggcatgtacctgagctgc
ctcaccacctcccgctccatgactgacaaactggcctttgatgtgggactgcaggaggat
gcaacaggagaggcctgttggtggacaatgcacccagcctccaagcagaggtctgaagga
gaaaaggtccgcgttggggatgacctcattctcgttagtgtctcctctgagcgctacctg
cacctgtcaacggccagtggggagctccaggttgacgcctccttcatgcagacactgtgg
aacatgaaccccatctcctctggctgcgaagagggttatgtgactggaggccatgtcctc
cgcctctttcatggacacatggatgagtgtctgactatctcctccgctgacagtgatgac
cagcgcagactcgtccattacgagggaggagctgtgtgtacccatgctctccctctgaga
atcagctggagtgggagccacctgcgctggggccagccgcttcgcatccggcatgtcacc
acagggcgctacctggcgctcactgaggaccagggcctggtggtggttgacgccagcaaa
gcccacaccaaggcgacctccttctgttttcgtatctccaaggaaaagctggatatggcc
cccaagcgggatgtagaaggcatggggccccccgagatcaagtatggagagtcactgtgc
ttcgtgcagcatgtggcctcaggcctgtggctcacctatgctgccccggaccccaaggcc
ctgcggctcggcgtgctcaagaggaaggccatgctgcaccaggaaggccacatggatgat
gcgctgtccctgacccgctgccagcaggaggagtcccaggctgcccgtatgatctacagc
actgctggcctgtacaaccagttcatcaaaggcctggatagcttcagcgggaagccgcgg
ggctcagggccaccggctggcacagcgctgcccatcgagggcgtcatcctgagcctgcaa
gacctcatcggctacttcgaaccaccctccgaggagctgcagcacgaggagaagcagagc
aaactgcgcagcttgcgcaaccgccagagcctcttccaggaggaggggatgctctccctg
gtcctgaattgcatcgaccgcctaaatgtctacaccacagctgcccactttgctgaattt
gccggggaggaggcagccgagtcctggaaagagattgtgaacctgctctatgaactcctg
gcttctctgatccgtggcaatcgtaccaactgtgccctcttctccaccaacttggattgg
ttggtcagcaagctggataggctggaggcctcatctgggatcctggaagtgctatactgt
gtcctgattgagagtcctgaggtcctgaacatcatccaagagaaccacatcaagtcaatc
atctcactcctggacaaacatgggaggaaccacaaggtgctggatgtgctgtgttccctg
tgtgtgtgtaatggcgtggctgtgcgctccaatcaagatctcattactgagaacttactc
cctggccgcgagcttctgctccagacaaacctcatcaactatgtcaccagcatccgccct
aacatctttgtgggccgagcagagggcaccacgcaatacagcaaatggtactttgaggtg
atggttgatgaagtggctccattcctgacagctcaggccacccacctacgggtgggctgg
gccctcactgagggctacagcccctacccagggggcggcgagggctggggcggcaacggg
gttggcgacgatctctattcctacggctttgatgggctgcatctctggacaggacatgtg
gcacggctggtgacttctccagggcagcacctcctggcccccgaggatgtggtcagttgc
tgcttggatctcagtgttccatccatctccttccgcatcaatggatgtcctgtgcagggt
gtctttgaggccttcaaccttgatgggcttttcttccctgttgtcagcttctcagccggt
gtcaaggtgcggttcctccttggtggccgccacggtgaatttaagttccttcccccgcct
ggctatgccccatgccatgaggctgttctccctcgagatcgactccacctggaacccatc
aaggaataccggcgggaggggccaagagggccacacctggtgggccccagccgctgcctc
tcacacaccgactttgtgccctgccccgtggacactgtccagattgtcctgcctccccat
ctggagcgtattcgggagaagctggcagagaacattcatgaactctgggcactgactcgc
attgagcaaggatggacctatggcccggttcgggatgacaataagaggctgcacccatgt
cttgtgaacttccacagcctaccagagccggagaggaattacaacctgcagatgtcaggg
gagacgctcaagacactgctggcgctgggctgccacgtgggcatggcagatgagaaggcg
gaggacaacctaaagaagacgaaactccccaagacgtatatgatgagcaatgggtacaaa
ccagcgcccctggacctgagccacgtgcggctgacaccggcgcagacgacgttggtggac
aggctggcagaaaatgggcacaacgtgtgggcacgagaccgtgtggcccagggctggagc
tacagtgctgtgcaggacatccccgcacgccgaaaccctcgcctcgtgccctaccgccta
ctggacgaggccaccaagcgcagcaacagggacagcctctgccaggccgtgcgcaccctg
ctgggctatggctacaacattgagccacctgaccaggagcccagtctggtggagagccag
tctcgctgggaccgcgtgcgcatcttccgggcagagaaatcctatgtggtgcagagcggc
cgctggtacttcgagtttgaggcggtcaccacgggcgagatgcgagtgggctgggcgagg
cccgagctgcggcctgacgtggagctgggagctgatgagctggcctatgtcttcaacggg
caccgtggccagcgctggcacttgggcagtgaaccatttgggcgcccctggcagtcgggt
gatgttgtgggctgcatgattgacctcacagagaacaccattatcttcaccctcaatggc
gagatcctcatgtccgattcaggctccgaaacagccttccgggatattgagattggggac
ggcttcctgcccgtgtgcagcttgggacctggccaggtgggtcacctgaatctgggtcag
gacgtgagctccctgcggttctttgccatctgcggtctccaggaaggcttcgagccattc
gccatcaacatgcagcgcccggtcaccacctggttcagcaaaagccttccccagtttgag
gctgtgccccttgagcacccccactatgaggtggcccgtgtggacggcactgtggacact
cccccctgcctgcgcctgagccaccgcacctggggctcccagaacagcctggtggagatg
ctcttcctccggctgagccttccagtccagttccaccagcacttccgctgcactgcaggg
gccaccccgctggcttcccccggcctgcagcccccagccgaggatgaggcccgggcagcg
gaaccggacaccgactacgaaaacctgcgccgctctgctgggcgctggggcgagaccgaa
gggggcaaagagggaactgccaaagaggggctgcctgggggcacctcccaggctggggta
gaggcccaacctgtcagggcagagaatgagaaggacgccaccacagagaagaacaagaag
agagggttcttattcaaggccaagaaggccgccatgatgactcagacgccagccacccct
gctctgccccgactccctcgcgaggtggtgcccgccgatgaccgtgatgaccctgagatc
atcctcaacaccaccacgtactattactccgtgagggtctttgctggtcaggagcccagc
tgcgtgtgggtgggctgggtcacccccgattaccatcagcacgacatgaacttcgacctc
agcaaggtccgagcagtgacggtgacgatgggggacgaacaaggcaacatccacagcagc
ctcaagtgcagcaactgctacatggtgtggggcggggacttcgtgagctctgggcagcag
ggccggatcagccacacagaccttgtcattggctgcctggtggacttggccactggctta
atgacctttacagccaatggcaaggagagcaacacctttttccaggtggaacccaacaca
aagctctttcctgccgtctttgtcctgcccacccaccagaatgtcatccagtttgagctg
gggaagcagaagaacatcatgccactgtcggccgccatgtttctgagtgagcgcaagaac
ccagctccacagtgcccgccgcggctcgaggtgcagatgctgatgcccatctcttggagc
cgcatgcccaaccgcttcctgcaggtggagacacagcgagccggcgagcggctgggctgg
gccgtgcagtgccaggagccgctgatcatgatggcactgcacatccctgaggagaaccgg
tgcatggacatcctggagctgtccgagcgcctgaacctgcagcggttccattcccacacc
ctccgcctctatcgcgctgtgtgcgccctaggcaacaaccgcgtggcgcatgctctgtgc
agccacgtggaccaggcgcagctgctgcacgcgctggaggacgcgcacctgcctggcccg
ctgcgtgctggctactacgacctcctcatcagcatccacctcgaaagtgcctgccgcagc
cgccgctctatgctctccgagtatatcgtacccctcacgcctgagacccgcgccatcaca
ctcttcccatctgcaaaaagcacagataatgggccccgccgccacggcctgcctggcgtt
ggcgtcaccacctcgctgcggcctccacaccatttctcacccccctgtttcgtggttgcc
ctgccagttgctggggtggcagaagcccctgcccgcctcagtcccagcatccctctggag
gccctgagggacaaagcgctgaggatgctgggggaggcggtgcgagatggcggccagcac
gcacgcgaccctgttggggggtctgtggagttccagtttgtgcccgtgctcaagcttgtg
tccaccctgctggtgatgggtatctttggtgacgaggatgtgaaacagatattgaaaatg
attgagcctgaagtattcactgaggaagaggaggaggaagaggaagaggaggaggaagag
gaagatgaagaggagaaggaggaggatgaggaggaggaggcacaggagaaggaagatgaa
gaaaaggaggaagaggagacagcagaaggggaaaaagaagaaagcttggaggaagggctg
ctccagatgaaattgccagagtctgtgaaattacagatgtgccacctactggagtatttc
tgtgaccaagagctgcagcaccgcgtagagtctctggcagcctttgcagagcgctatgtg
gacaggctccagggcaaccagcgagaccgctacaacctcctcatgaaagccttcaccatg
tctgcagctgagactgcccgacgtacccgagagttccgctcgccaccccaggagcagatc
aacatgctagtgcacttcaaagatggtgaggaagtggaagattgtcctcttcctgaagag
attcgacaggatttgcttgaatttcatcaagacctgctggctcactgtggaattcagctg
gagggggaagaggaggaaccagaggaagaggccaccctgggcagccgcctgatgagcctg
ttggagaaagtacggctggtgaagaagaaggagaagaaacctgaggaggagctgcctgct
gaggagagcaaacccgagtcactacaggaactggtgtcccacacagtggtgcgctgggcc
caggaagactttgtgcagagccccgagctggtacgggccatgttcagcctcctgcaccgg
cagtatgacgggctcggggagctgctgcgtgccctgccccgggcgtacaccatctcgccc
tcctccatggaggacaccatgagcctgctcgagtgcctcggccagatccgctcgctgctc
atcgtgcagatgggcccccaggaggagaacctcatgatccagagcatcgggaacatcatg
aacaacaaagtcttttaccagcacccgaacctgatgcgggcactgggcatgcatgagaca
gtcatggaagtcatggtgaacgtcctcgggggtggtgaatccaaggagatccgcttcccc
aagatggtgacgagctgctgccgcttcctctgctacttctgtcgcatcagccggcagaac
cagcgctccatgttcgaccacctgagctacctgctggagaacagcagcatcggcctgggc
atgcagggctccacacccctggacgtggcagctgcctctgtcattgacaacaacgagctg
gccttggcattgcaggagcaggacctggagaaggtggtatcctacctggcgggctgtggc
cttcagagctgccctatgctcctggccaaaggatacccggatatcggctggaacccctgc
ggcggtgagcgctacctggacttcctgcgcttcgctgtctttgtcaacggcgagagcgtg
gaggagaacgccaacgtggtggtgcggctgctcatccgcaagcctgagtgcttcgggccg
gccctgcggggcgagggcggctcggggctgctggctgccatcgaggaggccatccgcatc
tccgaggaccctgcgcgggatggcccaggcgtccgcagggatcggcggagggaacacttc
ggggaggagccccctgaggaaaaccgggtgcacctgggacacgctatcatgtccttctat
gctgccttgatcgacctgcttggacgctgtgcaccagagatgcatttaatccaagctggc
aagggtgaggccctgcggatccgtgccatcctgcgctccctagtgcccctggacgacctt
gtaggcatcatcagcctcccgctgcagatccccaccctgggcaaagatggagctctggta
cagccaaagatgtcagcatcctttgtgccggaccacaaggcgtccatggtgctcttcctg
gaccgtgtgtatggcatcgagaaccaggaattcttgctgcatgtgctggacgtggggttc
ctgccagacatgagggcagccgcctcgctggacacggccaccttcagcaccaccgagatg
gcgctggcgcttaaccgctacctgtgcctggcggtgctgccgctcatcaccaaatgtgcg
ccactgtttgcgggaaccgagcaccgcgccatcatggtggactccatgcttcacacggtg
taccgcctttcccgtggccgctcgctcaccaaggcacagcgcgacgtcatcgaggattgc
ctcatggcactctgcaggtacatccggccgtccatgctgcagcacctgctgcggcgcctg
gtgtttgacgtgcccatccttaacgagttcgccaagatgccgctcaagctcctcaccaac
cactatgagcggtgttggaaatattactgcttgcccacgggctgggccaactttggcatc
acctcggaggaagagctgcacctcacaaggaaactcttctggggcatctttgactcgctg
gcccacaagaagtatgactcagagctgtaccgcatggctatgccgtgtctatgcgccatc
gcaggagccctgcccccagactatgtagacgcctcatactcatcgaaggctgagaaaaaa
gccacagtggatgctgaaggcaactttgatcctcgacctgtggagaccctcaacgtgatc
attccagagaagctggactccttcattaacaagtttgcggagtacacacatgagaagtgg
gcctttgataagatccagaacaactggtcctacggggagaacatagatgaggacctgaag
acccaccccatgctgaggccttacaagaccttctcggagaaggacaaagagatttaccgc
tggcccatcaaggaatccttgaaggccatgattgcctgggaatggacgatagagaaggcc
agggagggtgaggaggagaaggtggagaagaagaagactcggaagatctcccaaagtgct
cagacttacgatccgcgagaaggctacaaccctcagcctcctgacctcagcggagttacc
ctgtcccgggagctgcaggccatggcggaacaactggcggaaaattaccataacacctgg
gggcggaagaagaagcaggaacttgagaccaagggtggcgggacccaccccctgctggtc
ccctatgacacgctcacggccaaggagaaagcacgagatcgagagaaggcccaggagctc
ctgaagttcctgcagatgaacggttatgcggtcaccagaggccttaaggacatggagctg
gatacgtcttccattgagaaacggttcgcctttggcttcctgcagcagttgctgcgctgg
atggacatttcccaggagtttatcgcccacctcgaggctgtggtcagcagtggacgagtg
gaaaagtccccacatgaacaagagattaaattctttgccaagatcctgctccctttgatc
aaccagtacttcaccaaccactgcttgtatttcctgtccacacctgccaaagtgctgggc
agtggtggccacgcctccaacaaggagaaggaaatgatcaccagcctcttctgcaagctt
gccgctcttgtccgtcaccgagtctctctctttgggacggatgccccagctgtggtcaac
tgtcttcacatcctggcacgctctctggatgccaggacggtgatgaagtcaggccctgag
attgtgaaggctggccttcgttccttctttgagagtgcctcggaggacatcgagaagatg
gtggagaacctgaggctaggcaaagtgtcacaggcgcgcacacaagtgaagggcgtgggc
cagaacctcacctacaccaccgtggccctgctgcctgtcctcaccaccctcttccagcac
atcgcccagcaccagtttggagatgatgtcatcttggacgatgtccaggtctcgtgctac
cgaacgctgtgcagcatttactctctaggaacaaccaggaactcttatgtggaaaagctg
cggccagcgcttggggagtgcctggcccgcctggcagcggccatgccggtggcgttcctg
gagcctcagctgaatgagtataacgcctgctcggtgtacaccaccaagtccccccgggag
cgggccatcttggggctccccaacagcgtggaagagatgtgtcctgacatcccagtgctg
gagcggctcatggcagacatcggggggctggctgagtcgggggcccgctacacggagatg
ccacacgtcattgagataacactgcccatgctgtgcagctatctgccccgctggtgggag
cgcggacctgagatgcccccacccgccttgcctgctggggcccccccgccctgcacagct
gtcacctctgaccacctcaactccctgctgggtaatatcttgcgaatcatcgtcaacaac
ctgggcatcgatgaggcctcctggatgaagcggcttgctgtgtttgctcagcctattgtg
agccgggcccggcccgagctcctgcactcacacttcatcccgaccatcgggcggctgtgc
aagcgggcggggaaggtggtggccgaggaggagcagctgcgcctggaggccaaggcagaa
gctgaggagggcgagctcctggtgcgggatgagttctctgtgctctgccgggacctgtac
gctctctacccactgctcatccgctacgtggacaacaacagggcccactggctgacagag
cctgaccccagtgctgaggagctgttcaggatggtgggcgagatcttcatctactggtcc
aagtcccacaactttaagcgtgaggagcagaacttcgtggtccagaatgagatcaacaac
atgtcatttctgactgccgacaacaagagtaaaatggccaaggcgggagacgtacagtca
ggtggctcagaccaggaacgcacgaagaagaagcgccgaggggaccggtactctgtgcag
acgtcgctgattgtggccacactcaagaagatgctgcccattggcctgaacatgtgtgca
cccactgaccaggacctcatcacgctggccaagacccgctacgccctgaaagacacagat
gaggaagtccgggaatttttgcaaaacaaccttcaccttcagggaaaggtcgaaggctcc
ccttctctgcgctggcagatggccctgtaccgaggcctaccgggccgcgaggaggacgcc
gacgacccggagaagatcgtgcgcagagtccaggaggtgtccgcggtgctctatcatctg
gagcaggttgagcacccttacaagtctaagaaggctgtgtggcacaagctcttgtccaag
cagcgccgaagggcggttgttgcctgtttccgcatgactcccctgtacaacctgccgacg
caccgggcatgtaacatgttcctggagagctacaaggccacatggatcctgactgaagac
cacagttttgaggaccgcatgatagatgacctttcaaaagcaggggagcaggaggaggaa
gaagaggaggtggaagagaagaagccagaccccctgcaccagctcgtcctgcacttcagc
cgcacagccctgactgaaaagagcaaactggatgaggattttctgtatatggcatatgcg
gatatcatggcaaagagctgccacctggaggagggagcggagaacagtgaagctgaagaa
gaggctgaggtttctttcgaggagaaagagatggagaagcagaggctcctataccagcag
gcgcggctgcacaaccggggggctgcagagatggtgctccagatgatcagtgcctgcaaa
ggagagactggtgccatggtgtcctctaccctgaagctgggcatctccatcttaaatggg
ggcaatgctgatgtgcagcagaaaatgttggattatctgaaggacaagaaggaagttggc
ttcttccagagtatacaggcgctgatgcagacatgcagcgtcctggatctcaatgcattc
gagagacagaacaaggcagaggggctgggcatggtgaacgaggatggaactgtcatcaac
cgccagaacggagaaaaggtcatggcagatgacgaattcacccaagacctgttccgattc
ctgcaattgctctgcgaggggcataataatgatttccaaaactacctacggacacagaca
gggaacacgaccactattaacatcatcatctgcacagtggactaccttctgcggctgcag
gagtccatcagcgacttctactggtactactccggcaaggatgttattgaggagcaaggc
aagaggaacttttctaaggccatgtcggtggctaaacaggtgttcaacagtctcaccgag
tacatccagggcccctgcactgggaaccagcagagcttggcgcacagccgcctctgggac
gccgtggtgggattcctgcacgtgtttgcccacatgatgatgaagctcgctcaggactcg
agccagatcgagctgttgaaggagctgctggatctacagaaggacatggtggtgatgtta
ctgtcactactggaagggaacgtggtgaacggcatgattgcccggcagatggtagacatg
ctggtggaatcttcatccaacgttgagatgatcctcaagttcttcgacatgttcctgaaa
ctcaaggacatagtgggctcagaggccttccaagactacgtcactgatccccgtggcctc
atctccaagaaggacttccagaaggccatggacagccagaagcagttcactggtccagaa
atccagttcctgctttcgtgctctgaggcggatgagaatgagatgatcaactgtgaggag
ttcgccaaccgtttccaggagccagcccgtgaaatcggctttaacgtggcagtactgctg
accaatctgtctgagcacgtgccccatgacccgcgcctgcgcaacttcctagagctggct
gagagcatcctcgagtacttccggccctacctgggtcgcatcgagatcatgggcgcctct
cgccgcattgagcgcatctactttgagatatcggagaccaaccgcgcccagtgggagatg
ccgcaggtgaaggagtccaagcgccagttcatcttcgacgtggtgaacgagggcggcgag
tcggagaagatggagctcttcgtgagcttctgcgaggacaccatcttcgagatgcagatc
gccgcgcagatctcggagcccgagggcgagcccgaggaggacgacgacgagggcgcggcc
gaggcgggcgccgagggcgcggaggacggcgcggcggggcccgagggcgcagcggggccg
gcgggctgcgggcgggcggcgcgcgtggcggcggccggcggctcgggccctgcgcgggcc
tcagctaccgcggctgcgcggcgcgtgcggccggctgcgcggctgacggcgcgcggggcg
gcgggcggcgcgcgcgctcctctgggcggtggtggcgcggcgggggcggcgcgggggcgc
ggcggcgctctgcgtctgctctggggctccctcttcgggggcggcctcgtggagggggcc
aagaaggtgactgtgaccgagctgctggccggcatgcccgaccccacgggcgacgaggtg
catggagagcagccgtccgggcccggcagcgacgcagacggcgagggcgagggcgagggc
gcgggcgacgcctcggagggcgcgggcgacgaggaggcggcggcgcatgaggccggtccg
ggaggcgctgaccgggccgtggcggtggccgacgggggacctttccggcccgacggggcc
ccgggaggcctcggggacatgggtgacacgacgccagcggagccacccacgcccgagggc
tccccaatcctcaagaggaagctgggggtggatggagaggaagaggaagtgcctccagaa
ccagagcccgagccggagcctgagaaaactgatgcggagaatggggagaaggaagacgtt
cccgagcccgcgccagagccccccaagaagacagcacctcctccaccccctccaaagaag
gaggaagccggaggtgggggcctggaattttggggagagctggaagtgcagagggtgaag
ttcttgaactacctctcccggaatttttacaccctgcgattccttgccctcttcttggca
tttgccatcaacttcatcttgctgttttataaggtctcagactctccaccaggggaggat
gacatggagggctcagcagctggggacctggcaggtgctgggtctggtggtggctctggc
tggggttcaggagttggtgaggaagcagaggatgacgaggatgagaacatggtgtactac
ttcctggaggagagcacgggctacatggagcctgccttgcgttgcttaagcctactgcat
acactggtggcctttctctgcatcattggctacaactgcctcaaggtacccctggtgatc
tttaagagggagaaggagctggcccgaaagctggagtttgacggcctctatatcaccgag
cagcctgaggacgacgacgtgaaggggcagtggaaccgactggtgctcaatacaccgtca
ttccccagcaactattgggacaagtttgtcaagcggaaggtcctggacaagcacggggac
atctttgggcgggagcggatcgctgagctgctgggcatggatctagccacgctggagatc
acagctcacaacgagcgcaagccagaaccaccgccggggctgcttacctggctcatgtcc
atcgacgtcaagtaccagatttggaagttcggggtcatcttcacagacaattccttcctg
tacctgggctggtacatggtgatgtccctccttgggcactacaacaacttcttctttgct
gcccacctcctggacatcgccatgggggtcaagacactgcgaaccatcctctcctctgtc
acccacaacgggaaacagctggtgatgaccgtgggcctcctggcagtggtggtctacctg
tacactgtggtggccttcaacttcttccgcaaattctacaacaaaagcgaggatgaggat
gagcctgacatgaaatgtgatgacatgatgacgtgttacctgtttcacatgtacgtgggt
gtccgagctggtgggggcattggggatgagattgaggacccagcaggtgatgaatatgag
ctgtaccgggtggtcttcgacatcaccttcttcttcttcgtcatcatcatcctgctggcc
atcatccagggtctgatcattgatgcttttggcgagctccgagaccaacaagagcaagtg
aaggaagatatggagaccaagtgcttcatctgcggcattggcagcgattactttgacacc
acaccacatgggttcgagacccacacgctggaagagcacaacctggccaattacatgttt
ttcctgatgtacctgataaacaaggacaagacagaatacacgggtcaggagtcttatgtt
tggaagatgtaccaagagagatgctgggacttcttcccggctggtgactgtttccgcaag
cagtacgaggaccagctcagctga

DBGET integrated database retrieval system