KEGG   Rousettus aegyptiacus (Egyptian rousette): 107518868
Entry
107518868         CDS       T06036                                 

Gene name
SHH
Definition
(RefSeq) LOW QUALITY PROTEIN: sonic hedgehog protein
  KO
K11988  sonic hedgehog
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04340  Hedgehog signaling pathway
ray04360  Axon guidance
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05217  Basal cell carcinoma
ray05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    107518868 (SHH)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    107518868 (SHH)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107518868 (SHH)
   05205 Proteoglycans in cancer
    107518868 (SHH)
  09162 Cancer: specific types
   05226 Gastric cancer
    107518868 (SHH)
   05217 Basal cell carcinoma
    107518868 (SHH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ray01002]
    107518868 (SHH)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:ray00536]
    107518868 (SHH)
Peptidases and inhibitors [BR:ray01002]
 Cysteine peptidases
  Family C46: hedgehog family
   107518868 (SHH)
Glycosaminoglycan binding proteins [BR:ray00536]
 Heparan sulfate / Heparin
  Morphogens
   107518868 (SHH)
SSDB
Motif
Pfam: HH_signal Hint Peptidase_M15_3 Vint
Other DBs
NCBI-GeneID: 107518868
NCBI-ProteinID: XP_016016423
LinkDB
Position
Unknown
AA seq 443 aa
MLLLARCLPLAFVWSLLLCSGLACGPGRGFGKRRHPKKLTPLAYKQFIPNVAEKTLGASG
RYEGKISRNSERFKELTPNYNPDIIFKDEENTGADRLMTQRCKDKLNALAISVMNQWPGV
KLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRSKYGMLARLAVEAGFDWVYYESKAH
IHCSVKAENSVAAKSGGCFPGSATVHLEQGGTKRVKDLRPGDRVLAADEQGRLLYSDFLT
FLDRDDGAKKVFYVIETREPRERLLLTAAHLLFVAPHNDSGAGRPPGGAPGRRALFASRV
RPGQRVYXVAERGGDRRLLPXAVHSVTLREEAAGAYAPLTAQGTILINRVLASCYAVIEE
HGWAHRAFAPFRLAHALLAALAPARTDRGGDGDGGGGGRAPSARGAPAAAAGVHWYSRLL
YQIGTWLLDSEALHPLGMAVKSS
NT seq 1332 nt   +upstreamnt  +downstreamnt
atgctgctgctggcgcgatgcctgccgctggcgttcgtctggtcgctgctgctgtgctcg
gggctggcgtgcggacccggcagggggttcgggaagaggcggcaccccaaaaagctgacc
cctttagcctacaagcagtttatccccaacgtggcggagaagacgctcggggccagcgga
agatacgaagggaagatctcaagaaactccgagcggttcaaggagctcacccccaattac
aaccccgacatcatattcaaggatgaggagaacacgggcgcggacaggctgatgactcag
aggtgtaaggacaagttaaatgctttggccatctcggtgatgaaccagtggccaggagtg
aagcttcgcgtgaccgagggctgggacgaggacggccaccactcggaggagtcgctgcac
tatgagggccgcgcggtggacattaccacgtcggaccgtgaccgcagcaagtacggcatg
ctggcgcgcctggcggtggaggccggcttcgactgggtgtactacgagtccaaggctcac
atccactgctccgtgaaagcagagaactcggtggcggccaagtcgggcggctgcttcccc
ggctcggccacggtgcacctggagcagggcggcacgaagcgcgtgaaggacctgcggccc
ggcgaccgcgtgctggcggccgacgagcagggccggctgctctacagcgacttcctcacc
ttcctggaccgcgacgacggcgccaagaaggtcttctacgtgatcgagacgcgcgagccg
cgcgagcgcctgctgctcaccgcggcgcacttgctcttcgtggcgccgcacaacgactcg
ggcgccgggcggccgccggggggcgcgccggggcgccgggcgctcttcgccagccgcgtg
cggccgggccagcgcgtgtacngtgtggccgagcgcggcggggaccgccggctgctgccg
nccgccgtgcacagcgtgacgctgcgcgaggaggcggcgggcgcgtacgcgccgctcacg
gcgcagggcaccatcctcatcaaccgggtgctggcgtcgtgctacgcggtcatcgaggag
cacggctgggcgcaccgcgccttcgcgcccttccgcctggcgcacgcgctgctggccgcg
ctggcgcccgcgcgcacggaccgcggcggggacggcgacggcgggggcgggggccgcgcc
cccagcgcgcggggggcgccggcggcggcggcgggcgtccactggtactcgcggctgctc
taccaaataggcacctggctgttggacagcgaggccctgcaccctctgggcatggcggtc
aagtccagctga

DBGET integrated database retrieval system