KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519111
Entry
107519111         CDS       T06036                                 

Gene name
TGFA
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04915  Estrogen signaling pathway
ray05200  Pathways in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05223  Non-small cell lung cancer
ray05225  Hepatocellular carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519111 (TGFA)
   04012 ErbB signaling pathway
    107519111 (TGFA)
   04014 Ras signaling pathway
    107519111 (TGFA)
   04151 PI3K-Akt signaling pathway
    107519111 (TGFA)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    107519111 (TGFA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519111 (TGFA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107519111 (TGFA)
   05212 Pancreatic cancer
    107519111 (TGFA)
   05225 Hepatocellular carcinoma
    107519111 (TGFA)
   05214 Glioma
    107519111 (TGFA)
   05211 Renal cell carcinoma
    107519111 (TGFA)
   05215 Prostate cancer
    107519111 (TGFA)
   05223 Non-small cell lung cancer
    107519111 (TGFA)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107519111 (TGFA)
SSDB
Motif
Pfam: EGF EGF_2
Other DBs
NCBI-GeneID: 107519111
NCBI-ProteinID: XP_016016873
LinkDB
Position
Unknown
AA seq 159 aa
MVTSAGQLALFALGLLLAVCQALENTTSALSDPPMAAAVVSYFNDCPDSHSQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVASSQKKQAITALVVVSIVALAGLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV
NT seq 480 nt   +upstreamnt  +downstreamnt
atggtcacctcggctggacagctcgccctgttcgcgctgggtcttttgttggctgtgtgc
caggccctggagaacaccacatccgccttgagtgacccgcccatggccgcagctgtggtg
tcttattttaatgactgcccggattcccacagtcagttttgcttccatggaacctgcagg
tttttggtgcaggaggacaagccagcatgtgtctgccattctgggtacgttggagcgcgc
tgtgagcacgcggacctcctggctgtggtggcctccagccagaagaagcaggccatcact
gccttagtggtggtctccatcgtggccctggctggcctcatcatcacgtgtgtactgatt
cactgctgccaggtccgaaaacactgtgagtggtgccgggccctcatctgccggcacgag
aagcccagtgccctcctgaaaggaaggactgcttgctgccactcagaaacagtggtctga

DBGET integrated database retrieval system