KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519160
Entry
107519160         CDS       T06036                                 

Gene name
PAK1
Definition
(RefSeq) serine/threonine-protein kinase PAK 1 isoform X1
  KO
K04409  p21-activated kinase 1 [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04360  Axon guidance
ray04392  Hippo signaling pathway - multiple species
ray04510  Focal adhesion
ray04625  C-type lectin receptor signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04810  Regulation of actin cytoskeleton
ray05132  Salmonella infection
ray05170  Human immunodeficiency virus 1 infection
ray05205  Proteoglycans in cancer
ray05211  Renal cell carcinoma
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519160 (PAK1)
   04012 ErbB signaling pathway
    107519160 (PAK1)
   04014 Ras signaling pathway
    107519160 (PAK1)
   04392 Hippo signaling pathway - multiple species
    107519160 (PAK1)
   04024 cAMP signaling pathway
    107519160 (PAK1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107519160 (PAK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107519160 (PAK1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107519160 (PAK1)
   04650 Natural killer cell mediated cytotoxicity
    107519160 (PAK1)
   04660 T cell receptor signaling pathway
    107519160 (PAK1)
   04666 Fc gamma R-mediated phagocytosis
    107519160 (PAK1)
   04062 Chemokine signaling pathway
    107519160 (PAK1)
  09158 Development and regeneration
   04360 Axon guidance
    107519160 (PAK1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107519160 (PAK1)
  09162 Cancer: specific types
   05211 Renal cell carcinoma
    107519160 (PAK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107519160 (PAK1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107519160 (PAK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107519160 (PAK1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107519160 (PAK1)
   03036 Chromosome and associated proteins [BR:ray03036]
    107519160 (PAK1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107519160 (PAK1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: STE group
  STE20 family
   107519160 (PAK1)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107519160 (PAK1)
 Endocytosis
  Macropinocytosis
   Kinases
    107519160 (PAK1)
Chromosome and associated proteins [BR:ray03036]
 Eukaryotic type
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     107519160 (PAK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr PBD Kinase-like Pkinase_fungal APH DSHCT Kdo
Other DBs
NCBI-GeneID: 107519160
NCBI-ProteinID: XP_016016986
LinkDB
Position
Unknown
AA seq 544 aa
MSNNGLDIQDKPPAPPMRNTSTMIGAGSKDAGTLNHGSKPLPPNPEEKKKKDRFYRSILP
GDKTNKKKEKERPEISLPSDFEHTIHVGFDAVTGEFTGMPEQWARLLQTSNITKSEQKKN
PQAVLDVLEFYNSKKTSNSQKYMSFTDKLAEDYNSSNTLNVKTVSETPAVPPVSEDEDDD
DDATPPPVIAPRPEHTKSVYTRSVIEPLPVTPTRDVATSPISPTENNTTPPDALTRNTEK
QKKKPKMSDEEILEKLRSIVSVGDPKKKYTRFEKIGQGASGTVYTAMDVATGQEVAIKQM
NLQQQPKKELIINEILVMRENKNPNIVNYLDSYLVGDELWVVMEYLAGGSLTDVVTETCM
DEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMDGSVKLTDFGFCAQITPEQSKR
STMVGTPYWMAPEVVTRKAYGPKVDIWSLGIMAIEMIEGEPPYLNENPLRALYLIATNGT
PELQNPEKLSAIFRDFLNRCLEMDVEKRGSAKELLQHQFLKIAKPLSSLTPLIAAAKEAT
KNNH
NT seq 1635 nt   +upstreamnt  +downstreamnt
atgtccaataacggcctagacattcaggataaacccccagcccctccaatgagaaacacc
agcactatgattggagctggcagcaaagatgctggaaccctgaaccatggttccaaacct
ctgcctccaaatccagaggagaagaaaaagaaggaccgattttaccgatccatcttacct
ggagataaaacaaataaaaagaaggagaaggaacggccagagatttctcttccttcagat
ttcgagcacacaattcacgttggttttgatgccgtcacaggggagtttacagggatgcca
gagcagtgggcccgcttacttcagacatcaaatatcactaagtcggagcagaagaaaaac
ccacaggctgttctggatgtattggaattctataactcaaagaagacgtccaacagtcag
aagtacatgagctttacagataaattagctgaggattataattcttctaacactttgaat
gtgaagacggtgtctgagacccctgcagtaccaccagtttcagaagatgaagatgatgat
gatgatgctaccccacctccagtgattgctccacgcccagagcacacaaaatctgtatac
acaaggtctgtgattgaaccacttccagttactccaactcgggatgtggctacatctccc
atttcgcctaccgagaataataccactcccccagatgctctgactcggaatactgagaag
cagaagaagaagcctaaaatgtctgatgaagagatcttggagaaattacggagcatagtg
agtgtgggcgatcctaagaagaaatatacacggtttgagaagatcggacaaggtgcttca
ggcactgtgtacaccgcaatggatgtggccacaggacaggaggtggccattaagcagatg
aaccttcagcagcagccgaagaaagaactgattattaatgagatcctggtcatgagggaa
aataagaacccaaatattgtgaactatttggacagttaccttgtgggagatgagctgtgg
gttgtcatggaatacttggccggaggctctttgacagatgtggtgacggaaacctgtatg
gatgaaggccagattgcagctgtgtgccgcgagtgcctgcaggctttggagttcctgcat
tccaaccaggtcattcacagagacatcaagagcgacaacatcctgttgggaatggatggc
tctgtcaagctaactgattttggattctgtgcccagatcaccccagagcagagcaaacgg
agcaccatggtaggaaccccatactggatggcaccagaggttgtgacgcggaaggcttat
gggcccaaggtcgatatctggtccctgggcatcatggccatcgaaatgattgaaggggaa
cccccatacctcaatgaaaaccctctgagagccttgtacctcattgccaccaatgggact
ccagagcttcagaatccagagaagctgtcagctatcttccgagacttcctgaaccgctgt
ctcgagatggatgtggagaagagaggttcagctaaagagctgctgcagcatcagttcctg
aagattgccaagcccctctccagcctcactccactgattgccgcagcaaaggaagcaacc
aagaacaatcactaa

DBGET integrated database retrieval system