KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519177
Entry
107519177         CDS       T06036                                 

Gene name
AQP11
Definition
(RefSeq) aquaporin-11
  KO
K09870  aquaporin-11
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Brite
KEGG Orthology (KO) [BR:ray00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107519177 (AQP11)
Transporters [BR:ray02000]
 Other transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    107519177 (AQP11)
SSDB
Motif
Pfam: MIP
Other DBs
NCBI-GeneID: 107519177
NCBI-ProteinID: XP_016017054
LinkDB
Position
Unknown
AA seq 271 aa
MTALRGLWPEVQDTCTSLGLMLSIVLSVALARGVLRQQMHRPVAHAFVLEFLATFQLCCC
THELQLLSEQEPAHPTWALTLIYFFSLVHGLTLVGTSSNPCGVMMQMMLGGMTPEIGAMR
LLAQLIGALCSRYCIGALWSLGLTRYHVSERGFACRNPIQVDLPKAVITEAICSFIFHSA
LLHFEEVRTKLRIHLLAALITFLVYSGGSLTGAVFNPALALSLHFKCFDEAFLRFFIVYW
LAPSLGILLMILTFSFFIPWLHNDHTTNKKE
NT seq 816 nt   +upstreamnt  +downstreamnt
atgactgcgctgagggggctctggcccgaggtgcaggacacctgcacctcgctggggctt
atgctgtcgatcgtgctgtccgtggcgctggcccgcggggtcctccggcagcagatgcac
aggcccgtggcccacgccttcgtcttggagtttctggccaccttccagctctgctgctgc
acccatgagctgcaattgctgagcgagcaggaacccgcgcaccccacctgggcgctgaca
ctaatctatttcttctcgttggtgcatggcctgactctggtgggcacctccagcaacccg
tgcggcgtgatgatgcagatgatgctggggggaatgacccccgaaataggggcaatgaga
ctgttggctcagctgataggtgccctgtgcagcaggtactgcataggcgccctgtggagc
ctggggctgaccaggtatcacgtcagcgagaggggcttcgcttgcaggaatcccatccaa
gtcgatttgcccaaagccgtcatcacagaggccatctgctcctttatcttccacagcgct
ttgctgcacttcgaggaggtccgaaccaagcttcgtatccacctgctggcagcactcatc
acctttttggtctactcaggaggaagtctaacaggagctgtatttaatccagctttggca
ctttcattacatttcaagtgttttgatgaagcattccttcgattttttatagtatattgg
ctggctccttctttaggtatattgttgatgattttgacgttcagctttttcattccatgg
ctgcataatgaccatacaactaataaaaaggaataa

DBGET integrated database retrieval system