KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519182
Entry
107519182         CDS       T06036                                 

Gene name
STAT1
Definition
(RefSeq) LOW QUALITY PROTEIN: signal transducer and activator of transcription 1-alpha/beta
  KO
K11220  signal transducer and activator of transcription 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04062  Chemokine signaling pathway
ray04217  Necroptosis
ray04380  Osteoclast differentiation
ray04620  Toll-like receptor signaling pathway
ray04621  NOD-like receptor signaling pathway
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04658  Th1 and Th2 cell differentiation
ray04659  Th17 cell differentiation
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04933  AGE-RAGE signaling pathway in diabetic complications
ray04935  Growth hormone synthesis, secretion and action
ray05140  Leishmaniasis
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05162  Measles
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05169  Epstein-Barr virus infection
ray05171  Coronavirus disease - COVID-19
ray05200  Pathways in cancer
ray05212  Pancreatic cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05321  Inflammatory bowel disease
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    107519182 (STAT1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    107519182 (STAT1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107519182 (STAT1)
   04621 NOD-like receptor signaling pathway
    107519182 (STAT1)
   04625 C-type lectin receptor signaling pathway
    107519182 (STAT1)
   04658 Th1 and Th2 cell differentiation
    107519182 (STAT1)
   04659 Th17 cell differentiation
    107519182 (STAT1)
   04062 Chemokine signaling pathway
    107519182 (STAT1)
  09152 Endocrine system
   04917 Prolactin signaling pathway
    107519182 (STAT1)
   04935 Growth hormone synthesis, secretion and action
    107519182 (STAT1)
   04919 Thyroid hormone signaling pathway
    107519182 (STAT1)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107519182 (STAT1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519182 (STAT1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107519182 (STAT1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    107519182 (STAT1)
  09163 Immune disease
   05321 Inflammatory bowel disease
    107519182 (STAT1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    107519182 (STAT1)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    107519182 (STAT1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    107519182 (STAT1)
   05160 Hepatitis C
    107519182 (STAT1)
   05171 Coronavirus disease - COVID-19
    107519182 (STAT1)
   05164 Influenza A
    107519182 (STAT1)
   05162 Measles
    107519182 (STAT1)
   05168 Herpes simplex virus 1 infection
    107519182 (STAT1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519182 (STAT1)
   05169 Epstein-Barr virus infection
    107519182 (STAT1)
   05165 Human papillomavirus infection
    107519182 (STAT1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107519182 (STAT1)
   05140 Leishmaniasis
    107519182 (STAT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107519182 (STAT1)
Transcription factors [BR:ray03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   STAT
    107519182 (STAT1)
SSDB
Motif
Pfam: STAT_alpha STAT_int STAT_bind STAT1_TAZ2bind SH2 BLI1 TRPM_tetra DUF1633
Other DBs
NCBI-GeneID: 107519182
NCBI-ProteinID: XP_016017067
UniProt: C9K6U7
LinkDB
Position
Unknown
AA seq 749 aa
MSQWYELQQLDSKFLEQVHQLYDDSFPMEIRQYLAQWLEKQDWEHAANDVSFATIRFHDL
LSQLDDQYSRFSLENNFLLQHNIRKSKRNLQDNFQEDPIQMSMIIYNCLKEERKILENAQ
RFNQAQSGNIQSTVMLDKQKELDSKVRNVKDKVMCIEHEIKTLEDLQDEYDFKCKTSQNR
EHEANGVAKNDQKQEQMLLHKMYLMLDNKRKEVVLKIIELLNITELTQKALINDELVEWK
QRQQSACIGGPPNACLDQLQNWFTIVAESLQQVRQQLKKLEELEQKFTYDHDPITKNKQA
LWDRTFSLFQQLIQSSFVVERQPCMPTHPQRPLVLKTGVQFTVKLRLLVKLQELNYNLKV
KVLFDKDVNERNTVKGFRKFNILGTHTKVMNMEESTNGSLAAEFRHLQLKEQKNAGNRTN
EGPLIVTEELHSLSFETQLCQPGLVIDLETTSLPVVVISNVSQLPSGWASILWYNMLVTE
PRNLSFFLNPPCARWAQLSEVLSWQFSSVTKRGLNVDQLSMLGEKLLGPNAGPDGLIPWT
RFCKENINDKNFPFWLWIESILELIKKHLLSLWNDGCIVGFISKERERALLKDQQPGTFL
LRFSESCREGAITFTWVERSQNGGEPYFHAVEPYTKKELSAVTFPDIIRNYKVMAAENIP
ENPLKYLYPNIDKDHAFGKYYSRPKEAPEPMELDGPKGTGYIKTELISVSEVHPSLLQTT
DNLLPMSPEEFDEVSRIVGTVEFDSMMNV
NT seq 2250 nt   +upstreamnt  +downstreamnt
atgtcccagtggtatgagcttcagcaacttgactccaaatttctggagcaggttcaccag
ctctatgatgacagttttcccatggaaatcagacagtatctggcacagtggctagaaaag
caagactgggagcatgccgccaatgatgtttcctttgccaccatccgatttcatgacctc
ctgtcgcagctggatgatcaatacagtcgcttttctttggagaataatttcttgttgcag
cataacataaggaaaagcaagcgtaatcttcaggataattttcaggaagacccaatacag
atgtctatgatcatctataactgtctgaaggaggaaagaaaaatcctggaaaatgcccag
agattcaatcaggctcagtcagggaatattcagagcactgtgatgttagacaaacagaag
gagcttgacagcaaagtccgaaatgtgaaggataaagttatgtgtatagagcatgaaatc
aagaccctagaagatttacaggatgaatatgactttaaatgcaaaacctcacaaaacaga
gaacacgaagccaatggtgtggcaaagaatgaccagaaacaggaacagatgttactccac
aagatgtatttaatgcttgacaataagagaaaggaagtagttctcaaaataatagagttg
ttgaatatcaccgaacttacccagaaagccctgattaacgatgaactggtggaatggaag
caaagacaacagagtgcttgtattgggggacctcccaacgcttgccttgatcagttgcag
aactggttcaccatagttgcagagagtctgcagcaggttcgtcagcagcttaaaaagctt
gaggaattggaacagaaattcacctatgatcacgaccccattacaaaaaacaaacaggcc
ttatgggaccgcaccttcagccttttccagcagctcattcagagctcgtttgtagtggaa
agacagccttgcatgccaactcatcctcagaggccattggttttgaagactggggtacaa
ttcactgtgaagttgagactgttggtgaaattgcaagagctgaattataatttgaaagtc
aaagtcttatttgacaaagatgtgaatgagagaaatacagtaaaaggtttcagaaaattc
aacatcttgggcacgcatacaaaagtgatgaacatggaggagtccaccaatggaagtctg
gcggcagaatttcgacacctgcaactaaaggaacagaaaaatgccggcaacagaactaat
gagggccctctcatcgttactgaagagcttcactcccttagttttgaaacccagttgtgc
cagcctggtttggtcattgaccttgagactacctctctgcctgtcgtggtgatctccaac
gtcagccagctcccaagtggttgggcctccatcctgtggtacaacatgctggtgacagaa
cccaggaatctgtccttcttcttgaaccccccttgtgcacgatgggctcagctttcagag
gtgctgagttggcagttttcttctgtcaccaagagaggtctcaatgtggaccagctgagc
atgctgggagagaaacttcttggtcctaatgctggccctgatggtcttattccatggaca
aggttctgtaaggaaaatataaatgataaaaattttcctttctggctttggattgaaagc
atccttgaactcattaaaaaacacctgctctccctctggaatgatggctgtatcgtgggc
ttcatcagcaaggagcgagaacgtgctctattaaaggaccagcagcccgggacgttcctg
ctgcggttcagtgagagctgccgggaaggggccatcacgttcacgtgggtggagcggtcc
cagaatggcggcgaaccttacttccatgcggttgaaccttacacaaagaaagaactttct
gccgttactttccctgatattattcgcaattacaaagttatggccgctgaaaacattcca
gagaaccccctgaagtatctgtatccaaatattgataaagaccatgccttcggaaaatat
tactccagaccaaaggaagcaccagaaccgatggaactcgatggccctaaaggaactgga
tacatcaagactgaattgatttctgtgtctgaagttcacccttctctgcttcagaccaca
gacaaccttctgcccatgtctcctgaggagttcgatgaggtgtctcggatagtgggcact
gtagaattcgacagtatgatgaacgtatag

DBGET integrated database retrieval system