KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519185
Entry
107519185         CDS       T06036                                 

Gene name
GLS
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00220  Arginine biosynthesis
ray00250  Alanine, aspartate and glutamate metabolism
ray00471  D-Glutamine and D-glutamate metabolism
ray01100  Metabolic pathways
ray04724  Glutamatergic synapse
ray04727  GABAergic synapse
ray04964  Proximal tubule bicarbonate reclamation
ray05206  MicroRNAs in cancer
ray05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107519185 (GLS)
   00220 Arginine biosynthesis
    107519185 (GLS)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    107519185 (GLS)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107519185 (GLS)
  09156 Nervous system
   04724 Glutamatergic synapse
    107519185 (GLS)
   04727 GABAergic synapse
    107519185 (GLS)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107519185 (GLS)
   05230 Central carbon metabolism in cancer
    107519185 (GLS)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     107519185 (GLS)
SSDB
Motif
Pfam: Glutaminase EF-hand_14 Ank_2 Ank_4 Ank_3 Ank_5 Ank
Other DBs
NCBI-GeneID: 107519185
NCBI-ProteinID: XP_016017079
LinkDB
Position
Unknown
AA seq 678 aa
MMRLRGSAMLRDLLLRPPASSCAALKRAQPLATLCRRAQGGGPEAAGPAAAARLYPWWGG
GGRPAEPLARSLSSSPSEILQELGKGGAQQQQQQQQQQQQPGASPPAAQQTPGPKDGPGE
TDAFANSEGKELVASGENKIKQGLLPSLEDLLFYTIAEGQEKIPVHKFITALKSTGLRTS
DPRLKECMDMLRLTLQTTSDGVMLDKDLFKKCVQSNIVLLTQAFRRKFVIPDFMSFTSHI
DELYESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCLQSCVKPL
KYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSLIKQGVNN
AEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEGTDMVGIL
DFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCGMYDFSGQ
FAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSLCNFHNYD
NLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDYDSRTALH
VAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGD
SDNGKENQTVHKNLDGLL
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgatgcggcttcgaggctcggcgatgctgcgggacttgctcctgcggccccccgcctcc
tcctgcgcggctctgaaacgggcgcagccccttgccaccctgtgccggcgcgcccagggc
gggggaccagaggccgcgggcccggcggccgccgcacggctctacccgtggtggggtggg
ggcggccggccggcggagcccctcgcccggagcctgtcgagctccccctcagagatcctg
caggagctgggcaaggggggcgcgcagcagcaacagcagcagcagcagcagcagcaacag
cccggggcgtctccgcccgcggcccagcagacgcccggccccaaggacggccccggagag
acggacgcgttcgccaacagcgagggcaaggagttggtggcctcaggcgaaaataaaata
aaacagggtctgttacctagtttggaagatttgctgttctatacaattgcagaaggacaa
gagaaaatacccgttcataaatttattacagcactcaaatctacaggattgcgaacgtct
gatcccaggttgaaagagtgtatggatatgttaagattaactcttcaaacaacatcagat
ggtgtcatgctagacaaagatctttttaaaaaatgtgttcaaagcaacattgttttgttg
acacaagcctttaggagaaagtttgtcattcctgactttatgtcttttacctctcatatc
gatgagttatatgaaagtgctaagaaacagtctggaggaaaggttgcagattatattcct
caactagccaagttcagtcctgatttatggggtgtatctgtttgtacagtagatggacag
aggcattctattggagataccaaagttccattttgtcttcagtcctgtgtaaaacctttg
aaatatgccattgctgttaatgatcttggaacagaatatgtgcatcgatatgtggggaaa
gagcctagtggattaagattcaacaaactgtttttaaatgaagatgataagccacacaat
cctatggtaaatgctggagcgattgttgtgacttcattaataaagcaaggagtgaataat
gctgaaaaatttgactatgtgatgcagtttttgaataaaatggctggtaatgaatatgtt
ggattcagtaatgcaacgtttcagtctgaaagagaaagtggagatcgaaattttgcaata
ggatattacttaaaagaaaaaaagtgttttccagaaggtacagatatggttggtatatta
gacttctatttccagctgtgctccattgaagtaacttgtgaatcagctagtgtgatggct
gcaacactggctaatggtggtttctgtccaattactggtgaaagagtactgagccctgaa
gcagttcgaaatacactgagtttgatgcattcctgtggcatgtatgatttctcagggcag
tttgctttccatgttggtcttcctgcaaaatctggagttgctgggggcattcttttagtt
gtccccaatgtcatgggcatgatgtgctggtctccccctctggacaagatgggcaacagt
gttaagggaattcacttctgtcatgatcttgtttctctgtgtaatttccataactatgat
aatttgagacactttgcaaaaaaacttgatcctcgtagagaaggtggtgatcaaagggta
aagtcagtgataaaccttttgtttgctgcatatactggagatgtatctgcacttcgaaga
tttgctttgtcagcgatggatatggaacagcgagactacgattctagaacagcgctccat
gtagctgctgcagagggtcatgttgaagttgtcaaattcttgctggaagcctgcaaagta
aaccctttccccaaggataggtggaataacactcccatggatgaagcactgcactttggg
caccatgatgtgtttaaaatcctccaggaataccaagtccagtacacacctcaaggagat
tccgacaatgggaaggaaaatcaaaccgtccataagaatcttgatggactcttgtaa

KEGG   Rousettus aegyptiacus (Egyptian rousette): 107521222
Entry
107521222         CDS       T06036                                 

Gene name
GLS2
Definition
(RefSeq) glutaminase liver isoform, mitochondrial isoform X1
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00220  Arginine biosynthesis
ray00250  Alanine, aspartate and glutamate metabolism
ray00471  D-Glutamine and D-glutamate metabolism
ray01100  Metabolic pathways
ray04724  Glutamatergic synapse
ray04727  GABAergic synapse
ray04964  Proximal tubule bicarbonate reclamation
ray05206  MicroRNAs in cancer
ray05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    107521222 (GLS2)
   00220 Arginine biosynthesis
    107521222 (GLS2)
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    107521222 (GLS2)
 09150 Organismal Systems
  09155 Excretory system
   04964 Proximal tubule bicarbonate reclamation
    107521222 (GLS2)
  09156 Nervous system
   04724 Glutamatergic synapse
    107521222 (GLS2)
   04727 GABAergic synapse
    107521222 (GLS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107521222 (GLS2)
   05230 Central carbon metabolism in cancer
    107521222 (GLS2)
Enzymes [BR:ray01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     107521222 (GLS2)
SSDB
Motif
Pfam: Glutaminase Ank_2 Ank_4 EF-hand_14 Ank_5 Ank Ank_3
Other DBs
NCBI-GeneID: 107521222
NCBI-ProteinID: XP_016021189
LinkDB
Position
Unknown
AA seq 491 aa
MSQMRHMVRQSSSGGLLDRELFRKCVSSNIVLLTQAFRKKFVIPDFEEFTGHVDRIFEDA
KELTGGKVAAYIPQLAKSNPDLWGVSLCTVDGQRHSVGHTKIPFCLQSCVKPLTYAISVS
TLGTDYVHKFVGKEPSGLRYNKLSLNEEGIPHNPMVNAGAIVVSSLIKMECNKAEKFDFV
LQYLNKMAGNEYMGFSNATFQSEKETGDRNYAIGYYLKEKKCFPKGVDMMAALDLYFQLC
SVEVTCESGSVMAATLANGGICPTTGESILSAEAVRNTLSLMHSCGMYDFSGQFAFHVGL
PAKSAVSGAILLVVPNVMGMMCLSPPLDKLGNSHRGIHFCQKLVSLFNFHNYDNLRHCTR
KLDPRREGGEVRNKTVVNLLFAAYSGDVSALRRFALSAMDMEQKDYDSRTALHVAAAEGH
IEVVKFLIEACKVNPFVKDRWGNIPLDDAVQFNHLEVVKLLQDYQDSYTPSETQAEAGAE
ALSKENLESMV
NT seq 1476 nt   +upstreamnt  +downstreamnt
atgagccagatgcgccacatggttcgacagtccagcagtggtggcctcttggaccgagaa
cttttccgaaagtgtgtgagcagcaacattgtgctcctgacccaggcatttcgaaagaag
tttgtcattcctgattttgaggagttcacgggccatgtggatcgcatctttgaggatgcc
aaagagctcactggaggcaaagtggcagcctacatccctcagttggccaagtcaaatcca
gacctgtggggtgtctccctgtgcactgtggatggtcagcggcactctgtgggccacaca
aagatccccttctgcctgcagtcctgtgtgaagcccctcacctatgccatctctgtaagc
accctaggcactgactatgtgcacaagtttgtgggcaaagagcccagcggcctgcgctac
aacaagctctcccttaatgaggaaggaatcccccataaccccatggtcaatgctggtgcc
attgttgtgagctccctgatcaagatggaatgtaacaaagcagagaagtttgattttgtg
ttgcaatatctgaacaaaatggctgggaatgaatacatgggtttcagcaatgctacattc
cagtcagagaaggaaacaggggatcgaaattatgccattggctattatctgaaggaaaaa
aagtgctttcctaagggggtggacatgatggctgccctcgatctctacttccagctgtgc
tccgtggaggtaacctgtgaatcaggcagtgtcatggcagccaccctggccaatggtggg
atctgccccaccacaggcgagagcattctgagcgctgaggcagtgcgcaacactctcagc
ctcatgcactcctgcggcatgtacgacttctcgggccagtttgctttccatgtgggcctg
ccagctaagtcagctgtgtcaggagccatcctcctggtggtacccaatgtcatgggaatg
atgtgtctttcacctccactggacaagctggggaacagccataggggcatccacttctgc
cagaagttggtgtctctcttcaatttccacaactatgacaacctgaggcactgtactcgg
aagttagacccacggcgtgaagggggagaagttaggaacaagactgtggtgaatctgtta
tttgctgcctatagtggagatgtctctgctcttcgaaggtttgccttgtcggccatggac
atggaacagaaagactatgactcccgcacagccctgcatgttgctgcagctgaaggacac
attgaagttgttaaattcctgattgaggcttgcaaagtgaatccttttgtcaaggacagg
tggggcaacattcccctggatgacgctgtgcagttcaatcatctggaggtggtaaaactg
cttcaagactaccaggactcctacacaccatctgagactcaggctgaagcaggggctgag
gctctgtccaaagagaacttagagagcatggtgtga

DBGET integrated database retrieval system