KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519297
Entry
107519297         CDS       T06036                                 

Gene name
HMOX1
Definition
(RefSeq) heme oxygenase 1
  KO
K00510  heme oxygenase 1 [EC:1.14.14.18]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00860  Porphyrin and chlorophyll metabolism
ray01100  Metabolic pathways
ray04066  HIF-1 signaling pathway
ray04216  Ferroptosis
ray04978  Mineral absorption
ray05200  Pathways in cancer
ray05206  MicroRNAs in cancer
ray05225  Hepatocellular carcinoma
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    107519297 (HMOX1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    107519297 (HMOX1)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    107519297 (HMOX1)
 09150 Organismal Systems
  09154 Digestive system
   04978 Mineral absorption
    107519297 (HMOX1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519297 (HMOX1)
   05206 MicroRNAs in cancer
    107519297 (HMOX1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    107519297 (HMOX1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107519297 (HMOX1)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.18  heme oxygenase (biliverdin-producing)
     107519297 (HMOX1)
SSDB
Motif
Pfam: Heme_oxygenase
Other DBs
NCBI-GeneID: 107519297
NCBI-ProteinID: XP_016017291
LinkDB
Position
Unknown
AA seq 288 aa
MERLQPDSMPQDLSEALKEATKEVHTQAENAEFMKNFQKGQVTREGFKLVMASLYHIYKA
LEEEIERNKENPVYAPLYFPEELHRGTALEQDLAFWYGPRWQEVIPYTPAMRRYVQRLQE
VGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALELPNSGEGLAFFTFPNIDSATKFKQ
LYRARMNSLEMTPKVRQRVIEEAKTAFLLNIQLFEELQEWVTRKAEDQRPSQAPGLRRRA
GSGAQVSTPKETPRGKSQLNILSQVPLVRWVLTLSFLVATVAVGLYAM
NT seq 867 nt   +upstreamnt  +downstreamnt
atggagcgcctgcagcccgacagcatgccccaggatttgtcagaggccctgaaggaggcc
accaaggaggtgcacacccaggcggaaaatgctgagttcatgaagaactttcagaagggt
caggtgaccagagaaggctttaagctggtgatggcctccctgtaccacatctacaaggcc
ctggaggaggagatcgagcgcaacaaggagaacccagtctatgccccgctctacttcccg
gaagagctgcaccgggggaccgcgctggagcaggacttggccttctggtacgggccccgc
tggcaggaggttatcccctacacgcccgccatgaggcgctacgtgcagcgcctccaggag
gtggggcgcacggagcccgagctgctggtggcccacgcctacacccgctacctgggcgac
ctgtccgggggccaggtcctcaagaagatcgctcagaaggccctggaactgcccaactcc
ggcgagggcctcgcattcttcaccttccccaacatcgacagcgccaccaagttcaagcag
ctgtaccgcgcccgcatgaactcgctggagatgacccccaaggtcaggcagagggtcatc
gaagaagccaagacggcattcctgctcaacatccagctctttgaggagttgcaggagtgg
gtgacccgaaaggctgaggaccagaggccctcgcaggcaccggggcttcgccggcgggct
ggcagcggggcgcaagtctcaactcccaaggagactcccagagggaagtcccagctcaac
atcctctcccaggtgccactagtccgatgggtcctcaccctcagctttctggtggcaacg
gttgccgtggggctttatgccatgtga

DBGET integrated database retrieval system