KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519367
Entry
107519367         CDS       T06036                                 

Gene name
BMPR2
Definition
(RefSeq) LOW QUALITY PROTEIN: bone morphogenetic protein receptor type-2
  KO
K04671  bone morphogenetic protein receptor type-2 [EC:2.7.11.30]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04060  Cytokine-cytokine receptor interaction
ray04350  TGF-beta signaling pathway
ray04360  Axon guidance
ray04390  Hippo signaling pathway
ray04550  Signaling pathways regulating pluripotency of stem cells
ray05206  MicroRNAs in cancer
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04350 TGF-beta signaling pathway
    107519367 (BMPR2)
   04390 Hippo signaling pathway
    107519367 (BMPR2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107519367 (BMPR2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    107519367 (BMPR2)
 09150 Organismal Systems
  09158 Development and regeneration
   04360 Axon guidance
    107519367 (BMPR2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    107519367 (BMPR2)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107519367 (BMPR2)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.30  receptor protein serine/threonine kinase
     107519367 (BMPR2)
Protein kinases [BR:ray01001]
 Receptor serine/threonine kinases (RSTK): TKL group
  TGFBR2 family [OT]
   107519367 (BMPR2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Activin_recp APH Cadherin_C_2
Other DBs
NCBI-GeneID: 107519367
NCBI-ProteinID: XP_016017436
LinkDB
Position
Unknown
AA seq 1042 aa
MTFSLQQPWRVPSLLWTVLLVSTAAASQNQERLCAFKDPYQQDLGIGESRISHENGTILC
SKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCST
DLCNVNFTENFPPPDTTPLSPPHSFNRDETIIIALASVSVLAVLIVASCFGYRMLTGDRK
QGLHSMNMMEAAASEPSLDLDNLKLLELIGRGRYGAVYKGSLDERPVAVKVFSFANRQNF
INEKNIYRVPLMEHDNIAHFIVGDERVTADGRMEYLLVMEYYPNGSLCKYLSLHTSDWVS
SCRLAHSVTRGLAYLHTELPRGDHYKPAISHRDLNSRNVLVKNDGTCVISDFGLSMRLTG
NRLVRPGEEDNAAISEVGTIRYMAPEVLEGAVNLRDCESALKQVDMYALGLIYWEIFMRC
TDLFPGESVPEYQMAFQTEVGNHPTFEDMQVLVSREKQRPKFPEAWKENSLAVRSLKETI
EDCWDQDAEARLTAQCAEERMAELMMIWERNKSVSPTVNPMSTAMQNERNLSHNRRVPKI
GPYPDYSSSSYIEDSIHHTDSIVKNISSEHSMSSTPLTIGEKNRNSINYERQQAQARIPS
PETSVTSLSTNTTTTNTTGLTPSTGMTTISEMPYPDETNLHATNISQPVGPTPVCLQLTE
EDLETNKLDPKEVDKNLKESSDENLMEHSLKQFSGPDPLSSTSSSLLYPLIKLAVEVTGQ
QDFTQAANGQACLIPDVPPTQIYPLPKQQNLPKRPTSLPLNTKNSTKEPRLKFGSKHKSN
LKQVETGVAKMNTINAAEPHVVTVTMNGVAGRNHSVNSHAATTQYANGAVPSGQTANTVV
HRAQEMLQNQFIGEDTRLILIPNINSSPDEHEPLLRREQQAGHDEGVLDRLVDRRERPLE
GGRTNSNNNNSNPCSEQNILTQDVPSTVADPGPSKPKRAQRPNSLDLSATNVLDGSSLQL
GESTQDGKSGSGEKIKKRVKTPYSLKRWRPSTWVISTESLDCEVNNNGSDRAVHSKSSTA
VYLAEGGTATTMVSKDIGMNCL
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgactttctcgctgcagcagccctggcgggtgccctcgctactatggacagtcctgctg
gtcagcactgcagccgcttctcaaaatcaagaacgcctatgtgcatttaaagatccatat
cagcaagaccttgggataggggagagtcgaatctctcatgaaaatggaacaatattatgc
tcaaaaggtagcacctgctatggcctatgggagaaatcgaaaggggatatcaatctcgta
aaacaaggatgttggtctcacattggagatccccaggagtgtcactatgaagaatgtgtg
gtaactacaacccctccctctattcagaatggaacatatcgtttctgctgttgtagcaca
gacttgtgtaatgtcaactttactgagaattttccacctccagatacaacaccactcagt
ccacctcattcatttaaccgagatgagacaataatcattgctttggcatcagtctctgta
ttagctgttttgatagttgcctcatgctttggatacaggatgctgacaggagaccgtaag
caaggtcttcacagtatgaacatgatggaggcagcagcatcagagccctctcttgaccta
gataatttaaaactgttggagctgattggtcggggtcgatatggagcagtatataaaggt
tccttagatgagcgtccagttgctgtaaaagtgttttcctttgcaaaccgtcagaatttt
atcaatgaaaagaacatttacagagtgcctttgatggagcatgacaacattgctcacttt
atagttggagatgagagagtcactgcagatggacgtatggagtatttgcttgtgatggag
tattatcccaatggatctctgtgcaagtatttgagtctccatacaagtgactgggtaagc
tcttgccgtctggctcattctgtgactagaggactggcttatcttcatacagaattacca
cgaggagatcattataaacctgcaatttcccatcgagatttaaacagtagaaatgttctg
gtgaagaatgatggaacctgtgttattagtgactttgggttgtccatgaggctgactgga
aatagattggtacgcccaggagaagaagataatgcagccataagtgaggttggcacaatc
agatatatggcaccagaagttctagaaggagctgtgaacctgagggactgtgaatcagct
ttgaaacaagtagacatgtatgcgcttggactaatctattgggagatatttatgagatgt
acagacctctttccaggtgaatctgtaccggaataccagatggcttttcagacagaagtt
ggaaaccatccaacttttgaagatatgcaggttctggtgtccagagaaaaacagagaccc
aagttcccagaagcttggaaagaaaatagcctggcagtgaggtcacttaaggagacaatc
gaagactgttgggaccaggatgcagaggctcggcttactgcacagtgtgctgaggagagg
atggctgaacttatgatgatctgggaaagaaacaaatctgtgagcccaacagtcaatcca
atgtctacggctatgcagaatgagcgcaacctgtcacacaataggcgtgtgccaaagatt
gggccttatccagattattcttcttcctcatacattgaagactctatccatcacactgac
agcattgtgaagaatatttcctctgagcattcgatgtccagcacacctttgacaataggg
gaaaagaaccgaaactcaattaactatgaacgacagcaagcacaagctcgaatccccagc
cctgaaaccagtgtcaccagcctgtccaccaacacaacaactacaaacaccactggcctc
actccaagcactggcatgaccactatatctgagatgccatacccagatgaaacaaatctt
catgccacaaatatttcacagccagttgggccaactcctgtctgcttacaactaacagaa
gaagacttggagaccaataagctagacccaaaagaagttgataagaacctcaaggaaagt
tccgatgagaatctcatggagcattctcttaaacagttcagtgggccagacccactgagc
agtaccagttctagcttgctttacccactcataaagcttgcagtagaagtgactggacag
caggacttcacacaggctgccaatggccaggcatgtttaattcctgatgtcccgcccact
caaatctatcctctccccaagcaacaaaaccttcctaagagacctactagtttgccttta
aacaccaaaaattcaacaaaagagccccggctgaaatttggcagcaagcacaaatcaaac
ttgaaacaagtagaaactggagttgccaagatgaatacaatcaatgctgcagaacctcat
gtggtgacagtcaccatgaatggtgtggcaggtagaaaccacagcgttaattcccatgct
gccactacccagtatgccaatggggcagtaccatctggccagacagccaacacagtggta
catagggcccaagaaatgctgcagaatcaattcattggtgaggacaccaggctgatatta
attccaaatattaattccagtcctgatgagcatgaacctttgttgaggcgagagcaacag
gctggccatgatgaaggtgttctggatcgtcttgtagacaggagggaacggccactggaa
ggtggccgaactaattccaataacaacaacagtaatccatgttccgagcaaaatattctt
acacaggatgttccaagcacagtagcggatcctggaccatcaaagcccaaaagagcacag
aggcctaattctttggatctttcagctacaaatgtccttgatggcagcagtttgcaatta
ggtgagtcaacacaagatggcaaatcaggatctggtgaaaagatcaagaaacgtgtgaaa
actccctattctcttaagcggtggcgcccctccacctgggtcatctccactgaatcactg
gactgtgaggtcaacaacaatggcagtgacagggcagttcattccaagtctagcaccgct
gtttaccttgcagaaggaggcactgccacaaccatggtgtctaaagatataggaatgaac
tgtctgtga

DBGET integrated database retrieval system