KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519371
Entry
107519371         CDS       T06036                                 

Gene name
CD28
Definition
(RefSeq) T-cell-specific surface glycoprotein CD28 isoform X1
  KO
K06470  CD28 antigen
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04514  Cell adhesion molecules
ray04660  T cell receptor signaling pathway
ray04672  Intestinal immune network for IgA production
ray04940  Type I diabetes mellitus
ray05162  Measles
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
ray05320  Autoimmune thyroid disease
ray05322  Systemic lupus erythematosus
ray05323  Rheumatoid arthritis
ray05330  Allograft rejection
ray05332  Graft-versus-host disease
ray05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    107519371 (CD28)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    107519371 (CD28)
   04672 Intestinal immune network for IgA production
    107519371 (CD28)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107519371 (CD28)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    107519371 (CD28)
   05323 Rheumatoid arthritis
    107519371 (CD28)
   05320 Autoimmune thyroid disease
    107519371 (CD28)
   05330 Allograft rejection
    107519371 (CD28)
   05332 Graft-versus-host disease
    107519371 (CD28)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    107519371 (CD28)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    107519371 (CD28)
  09172 Infectious disease: viral
   05162 Measles
    107519371 (CD28)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:ray04090]
    107519371 (CD28)
CD molecules [BR:ray04090]
 Proteins
  107519371 (CD28)
SSDB
Motif
Pfam: V-set_2 V-set
Other DBs
NCBI-GeneID: 107519371
NCBI-ProteinID: XP_016017444
LinkDB
Position
Unknown
AA seq 221 aa
MILRLLLALNFFPSIQVTENKILVKQSPMLVVYNNAVNLSCKYTYNLFSKEFRASLYKGA
DSAVEVCVVNGNYSHQLPFRSATGFNCDGKLGNETVTFYLWNLYVNQTDIYFCKIEVMYP
PPYIDNEKSNGTIIHVKENRLCPAHQFPDSSKPFWALVVVGGVLGFYSLLVTIAFCVCWR
KSKRNRILQSDYMNMRPRRPGPTRKLYQPYVPARDFAAYRS
NT seq 666 nt   +upstreamnt  +downstreamnt
atgatcctcaggctgctcctggctctcaacttcttcccctcaattcaagtaacagaaaac
aagattttggtgaagcagtcccccatgcttgtggtgtacaacaatgcggtcaaccttagc
tgcaagtatacctacaacctcttctcaaaggagttccgagcatccctttacaagggagca
gacagtgctgtggaagtctgtgttgtgaatggaaactactcccatcagcttccatttcgc
tcagctacaggattcaactgtgatggcaaattgggcaacgaaacagtgacattttacctc
tggaatttgtatgttaaccaaacggatatttacttctgcaaaatagaggtcatgtatcct
cctccttacatagacaatgagaagagcaatggaaccattatccacgtgaaagagaatcgc
ctttgtccagctcaccagtttcctgactcttctaagccattttgggcactggtggtggtt
ggtggagtcttgggattctacagcttgctagtaacaatagctttttgtgtttgctggagg
aagagtaagaggaaccggatccttcagagtgattacatgaacatgaggccccggcggccg
ggacccacccgcaagctctaccagccctatgtcccagcgcgtgactttgcggcctaccgc
tcctga

DBGET integrated database retrieval system