KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519452
Entry
107519452         CDS       T06036                                 

Gene name
BEST2
Definition
(RefSeq) bestrophin-2
  KO
K13879  bestrophin-2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09154 Digestive system
   04970 Salivary secretion
    107519452 (BEST2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ray02000]
    107519452 (BEST2)
Transporters [BR:ray02000]
 Other transporters
  Pores ion channels [TC:1]
   107519452 (BEST2)
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 107519452
NCBI-ProteinID: XP_016017661
LinkDB
Position
Unknown
AA seq 508 aa
MTVTYTARVANARFGGFSQLLLLWRGSIYKLLWRELLCFLGLYMVLSSAYRFVLTEGQKR
YFEKLVIYCDQYASLIPVSFVLGFYVNLVVHRWWNQYLCMPLPDALMCIVSGTVHGRDER
GRLYRRTLMRYAGLSAVLILRSVSTAVFKRFPTIDHVVEAGFMTREERKKFENLNSSYNK
YWVPCVWFSNLAAQARREGRIRDNSALKLLLEELTVFRGKCSMLFHYDWISVPLVYTQVV
TIAVYSYFLACLIGRQFLDPAQGYKDHNLDLFVPVFTLLQFFFYAGWLKVAEQLINPFGE
DDDDFETNFLIDRNFQVSMLAVDEMYDDLAMLEKDLYWDATEARAPYTAATAFQRLQPSF
QGSTFDITLAKEDMQFQRPDGLDVPLGEAQGDFLQRLLPVGPGMAAGGLLGRRLSLLRRK
NSCVSEASTAPSCTCASTQDGAAPECGCSDPLLDSGLREPEFELPSGPELPAPGSVTEPF
TTVSMPAPRGPAPPWLPSPIGEEEESLA
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgactgtcacgtacacagcccgcgtggccaatgcgcgattcggcggtttctctcagttg
ctgctgctgtggcgcgggagcatctacaaacttctctggcgggagctgctctgtttcctt
gggctctacatggtgctgagttctgcctatcgcttcgtgctgactgaagggcagaagcgc
tacttcgagaagctcgtcatttactgtgaccagtatgccagtctcatccctgtctctttt
gtgctcggcttttatgtgaacctggtggtacaccgctggtggaaccagtacctctgtatg
cctctgccggacgcgctcatgtgcatagtgtcgggaaccgtgcacggccgcgacgagcgc
ggccgcctctatcggcgcacgctcatgcgctatgcagggctctccgctgtgctcatcctg
cgctctgtcagcaccgccgtcttcaagcgcttccccaccatagaccacgttgtggaggct
gggtttatgacccgtgaggagcgcaagaagttcgaaaacctgaactcgtcctacaacaag
tattgggtgccctgcgtctggttctccaacctggcagcacaggcccggcgcgagggccgc
atccgcgacaacagcgcccttaaactgctgctcgaggagctgactgtgtttcggggcaag
tgttcgatgctctttcactatgactggatcagcgtacccctcgtctacacccaggtggtg
accattgcggtgtacagttacttcctggcctgcctcatcggtcgccagttcctagaccct
gcgcagggatacaaagaccacaatcttgacctgtttgtgcccgtcttcactctgctgcag
ttcttcttctacgctggctggctcaaggtagccgaacagctcatcaaccctttcggtgag
gacgacgacgactttgaaaccaactttctgattgaccgcaacttccaggtgtcaatgctc
gcagtggacgagatgtacgacgacctagccatgctggagaaggacctttactgggacgcg
accgaggctcgcgccccctacacagcagccaccgccttccagaggctgcaaccttccttc
cagggctccaccttcgacatcacgctggccaaggaggacatgcagttccagcggcccgat
ggcctggacgtgcccctgggcgaggcacagggcgacttcttgcagcgcctcctgccggtg
ggcccgggcatggctgcaggaggcctgctgggccggcgtctgtccttgctgcgccggaag
aacagctgtgtatcggaggcatccaccgcccctagctgcacgtgcgccagcacccaagac
ggcgcggccccagaatgcggctgcagtgacccactgctggactctggcctgcgggagccc
gaatttgagctcccctccgggcccgagctgcctgcccctgggtcagtcacggagcccttc
actacagtgtccatgcccgcgccccgggggccagcaccgccctggctgcccagccccatt
ggtgaggaggaggagagtctcgcctga

DBGET integrated database retrieval system