KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519502
Entry
107519502         CDS       T06036                                 

Gene name
ASIP
Definition
(RefSeq) agouti-signaling protein
  KO
K08725  agouti signaling protein
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107519502 (ASIP)
SSDB
Motif
Pfam: Agouti ETRAMP Chordopox_A30L
Other DBs
NCBI-GeneID: 107519502
NCBI-ProteinID: XP_016017751
LinkDB
Position
Unknown
AA seq 222 aa
MAETNCNALLFSLLHSPSLPYLSSSSRFSFSLFFLHQFPFPVPSLAGPPAPLGHLYYGVR
APAQRNQESRRAHSLATTPTAFPFPFSPPKMDVTRLFLATLLVCLCFLTAHSHLAPEENP
RDDRSLGNNSSIKLLDSPSISIVALNKKSKKMSRKEAEKKKRSSKRKPSMKVERPRPPPP
TPCVANRSSCKSPAPACCDPCASCSCRFFRSVCSCRVLNPNC
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagagaccaattgcaatgcactccttttctctttgcttcattcgccctcccttcct
tatctgtcttcctcttcccgtttctctttttctctcttcttccttcatcagtttcccttc
cctgtcccaagccttgctggtcctccagctccactgggacacttgtattatggggtaaga
gcaccagcccagagaaaccaggaaagcaggagggcacattctcttgccacaacccctact
gccttccctttcccatttagtcctcccaagatggatgttactcgcctgttcctggctacc
ctgctggtctgcctgtgtttcctcactgcccacagccatctggcacctgaagaaaatccc
agagatgacaggagcctggggaacaactcctccattaagttgttggattctccttctatc
tctatcgtggcattaaacaagaaatccaaaaagatgagcagaaaagaggcggaaaagaag
aagagatcttccaagagaaagccttcgatgaaggtggagcggccccggcccccaccgccc
accccctgcgtggccaaccgaagcagctgcaagtcgccggcgcccgcctgctgtgacccg
tgcgcctcctgcagctgccgcttcttccgcagcgtctgctcctgccgcgtgctcaacccc
aactgctga

DBGET integrated database retrieval system