KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519567
Entry
107519567         CDS       T06036                                 

Gene name
TIAM1
Definition
(RefSeq) T-lymphoma invasion and metastasis-inducing protein 1
  KO
K05731  T-lymphoma invasion and metastasis-inducing protein 1
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04530  Tight junction
ray04810  Regulation of actin cytoskeleton
ray05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    107519567 (TIAM1)
   04015 Rap1 signaling pathway
    107519567 (TIAM1)
   04024 cAMP signaling pathway
    107519567 (TIAM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    107519567 (TIAM1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107519567 (TIAM1)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    107519567 (TIAM1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    107519567 (TIAM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ray04990]
    107519567 (TIAM1)
Domain-containing proteins not elsewhere classified [BR:ray04990]
 Pleckstrin homology (PH) domain-containing proteins
  Dbl-Like RhoGEF family proteins
   107519567 (TIAM1)
SSDB
Motif
Pfam: RhoGEF Tiam_CC_Ex PH RBD PH_9 PDZ PDZ_6 PDZ_2 PH_11 DUF5534
Other DBs
NCBI-GeneID: 107519567
NCBI-ProteinID: XP_016017853
LinkDB
Position
Unknown
AA seq 1591 aa
MGNAESQNVEHEFYGEKHASLGRKHTSRSLRLSHKARRTRHASSGKVIHRNSEVSTRSSS
TPSIPQSLAENGLEPFSQEGALEDFGSPIWVDRVDMGLRPVSYTDSSVTPSVDSSIVLTA
ASVQSMPDSEESRLYGDDATYLAEGGRRQHPCTSNGPTFMETASFKKKRSKSADIWREDS
LEFSLSDLSQEHLTSNEEILGSAEEKDCEEARGMETRASPRRLSTCQRANSLSDLYAQKP
SAVMANGGPRGKFAGYCRNLVSDIPNLANHKMPPAAAEEALPYSNYNTLPCRKSHCLSEG
ATNPQISHSNSMQGRRAKTTQDVNAGEGSEFADSGIEGTTTDTDLLSRRSNATNSSYSPP
TGRAFVGSDSGSSSTGDAARQGVYENFRRELEMSTTNSESLEEAGSAHSDEQSSGTLSSP
GQSDILLTAAQGTVRKAGALAVKNFLVHKKNKKVESATRRKWKHYWVSLKGCTLFFYESD
GRSGIDHNSIPKHAVWVENSIVQAVPEHPKKDFVFCLSNSLGDAFLFQTTSQTELENWIT
AIHSACAAAVARHHHKEDTLRLLKSEIKKLEQKIDMDEKMKKMGEMQLSSVTDSKKKKTI
LDQIFVWEQNLEQFQMDLFRYRCYLASLQGGELPNPKRLLAFASRPTKVAMGRLGIFSVS
SFHALVAARTGETGVRRRTQAMSRSTSKRRSRFSSLWGLDTTSKKKQGRPSINQVFGEGT
DAVKKSLEGIFDDTVPDGKREKEMVLPSVHQHNPDCDIWVHEYFTPSWFCLPNNQPALTV
VRPGDTARDTLELICKTHQLDHSAHYLRLKFLIENKMQHYVPKPEEDIYELLYKEIEICP
KVTQNIQIEKSDTASDNYGFSLSSVEEDGVRKLYVNRVKETGLASKKGLKAGDEILEINN
RAAGTLNSSMLKDFLAQPSLGLLVRTYPELEGGAELLESPPHRVDGPVDLGESPLAFLAG
NPGHGLCSDQGSSAETAPEEAEGPDLESSDETDHSSKSTEQVAAFCRSLHEMNPSDPNSS
PQDSAGPQLATMRQLTDADKLRKVICELLETERTYVKDLNCLMERYLKPLQKETFLTQDE
LDVLFGNLTEMVEFQVEFLKTLEDGVRLVPDLEKLEKVDQFKKVLFSLGGSFLYYADRFK
LYSAFCASHTKVPKVLVKARTDPAFKAFLDAQNPKQQHSSTLESYLIKPIQRILKYPLLL
KELFALTDAESEEHYHLDVAIKTMNKVASHINEMQKIHEEFGAVFDQLIAEQTGEKKEVA
DLSMGDLLLHTTVIWPNPPASLGKWKKEPELAAFVFKTAVVLVYKDGSKQKKKLVGSHRL
SIYEEWDPFRFRHMIPTEALQVRALASADAEANTVCEIVHVKSESEGRPERVFHLCCSSP
ENRKDLLKAVHSILRDKHRRQLLKTESLPSSQQYVPFGGKRLCALKGARPAMSRAVSAPS
KSLGRRRRRLARNRFTIDSDAISASSPEKESQQPPGGGDTDRWVEEQFDLAQYEEQDDIK
ETDILSDDDEFCESVKGADVDRELQERLQAASLGQRERGRKPRDSHASRMTQLKKQAALS
GIGGGLASASEEVIWVRREDFASSRKLNTEI
NT seq 4776 nt   +upstreamnt  +downstreamnt
atgggaaacgcagaaagtcaaaatgtagagcatgagttttatggagaaaagcatgccagc
ctggggcgcaagcacacgtcccgctcgctgcgcctgtcgcacaaggcgcggcgcacgagg
cacgcctcctccgggaaggtgatccaccggaactccgaagtgagcacgcggtccagcagc
acccccagcatcccccagtccctggccgaaaatggcctggaacccttctcccaggaaggc
gccctggaggacttcgggagccccatatgggtggaccgcgtggatatgggcttgagaccc
gtgtcttacacggattcttctgtcactcccagcgtagacagcagcatcgtcctcacagca
gcctctgtgcagagcatgccagactcggaggagagcaggctttacggagatgacgctaca
tacttggctgagggaggcaggagacagcatccctgtacatccaacgggcccacgttcatg
gagacggcgagctttaagaagaaacgctccaaatctgcagacatctggcgggaggacagc
ctggaattctcactttctgatctgagccaagaacatttaacaagcaacgaagagatcttg
ggttccgcggaagagaaagactgcgaggaggctcggggtatggaaacccgggcgagtccg
cggcggctcagcacctgtcagcgtgccaattccctgagtgacttgtatgctcagaaaccc
tctgcggtgatggcaaacggggggccgaggggcaaatttgcaggctactgtcggaacttg
gtgtctgatatccccaaccttgcaaaccacaagatgccaccagctgccgctgaagaggct
cttccctacagtaattataacacacttccctgtaggaaatctcactgtctttctgaaggt
gccaccaacccacaaattagccatagcaacagcatgcaaggcagaagagcaaaaacaact
caggatgttaacgccggcgagggcagcgagtttgcagacagtgggatcgaaggaaccacc
accgacacggacctcctgtccaggcgatccaatgccaccaactccagctactcgcccccc
accggccgcgccttcgtgggcagcgacagcggcagcagctccacgggggatgcggcgcgc
cagggcgtgtacgagaacttccgccgggagctggagatgagcaccaccaacagcgagagc
ctggaggaggcgggctcggcgcacagcgacgagcagagcagcggcaccctgagctccccg
ggccagtcggacatcctgctcaccgcggctcagggcacggtgcgcaaggcgggcgcactg
gccgtcaagaacttcctggtgcacaagaagaacaagaaggtggagtcggccacccggagg
aagtggaagcactactgggtgtctctgaaagggtgcacgctctttttctacgagagtgat
ggcaggtctggaatagaccacaacagcatccccaagcacgccgtctgggtggagaacagc
attgtgcaggctgtgcctgagcaccccaagaaggactttgtcttctgcctcagcaattcc
ctgggcgatgccttcctctttcagaccaccagccagacggagctggagaactggatcacc
gccatccactccgcctgtgcagccgcggtcgctaggcatcaccacaaagaagacactctc
cggctcctgaagtcagaaatcaaaaaactggaacaaaagattgatatggacgagaagatg
aagaaaatgggcgagatgcagctgtcttcagtcactgactcaaagaagaagaaaactata
ttagatcagatcttcgtttgggagcagaatcttgaacagttccaaatggacctttttcgt
taccggtgttacttagccagcctccaaggcggagagctgccaaaccccaaaaggctactt
gcttttgcaagccgaccgacgaaagtggcaatgggccgtcttggaatcttttctgtatca
tcttttcatgccctggtggcagcacgcactggtgaaactggagtcagacgacgtactcag
gccatgtccaggtccactagcaagcgaaggagcaggttttcttctctttggggtctggac
actacctccaaaaagaagcagggacgcccaagcatcaatcaggtgtttggggagggaact
gatgctgtaaagaagtctttagaaggaatatttgatgacactgttccagatggcaagagg
gagaaagaaatggtcttacctagcgtccaccagcacaatcccgactgtgacatttgggtc
catgagtatttcactccgtcctggttctgtctgccgaataatcagccagccctgacggtc
gtccggccgggagacactgcccgggacaccctggagctgatctgcaagacacatcaactg
gatcattctgctcattatttgcgtctgaaattcctaatagaaaacaagatgcagcactac
gttccaaagcccgaggaggacatttatgagctgctgtacaaagaaattgaaatttgtcca
aaagtcactcagaacatccagattgagaagtcagacacagccagcgataattatgggttt
tcactttcttctgtggaagaagacggtgttcggaagctctacgttaatagggtgaaggaa
actggtttagcttctaagaaaggcctgaaggcgggagacgagattctcgagatcaataat
cgtgctgctggcaccctgaactcatcgatgctcaaagatttcctggcacagccatccctg
ggcctcctggtgaggacctaccctgagctggagggaggagctgagctgctggagagcccg
ccccaccgagtggacggccccgtggaccttggcgagagccccctcgccttcctcgccggc
aacccagggcacggcctctgcagtgatcagggcagcagtgctgagactgctccagaggaa
gccgaagggccggacttggagtcctcagatgagacggatcacagcagcaagagtacggaa
caggtggccgcattttgccgcagtctgcatgagatgaaccccagtgacccgaactcatca
cctcaggactctgccgggcctcagctggccaccatgagacagctcacggacgccgacaag
ctgcgcaaggtgatctgcgagctcctggagacggagcgcacctacgtgaaggacttaaac
tgtctcatggagagatacctaaaacctcttcagaaagaaacttttctcacccaagatgag
cttgatgtgctctttggaaatttaaccgaaatggtagagtttcaagtagaattccttaaa
actctagaagatggggtgagactggtacccgatttggaaaagcttgagaaagtcgatcag
tttaagaaagtgctgttctctctgggggggtcctttctgtactacgctgaccgcttcaag
ctctacagtgccttctgcgccagccacacgaaggtccccaaggtcctggtgaaagccagg
acagacccggctttcaaggcgttcttagacgcccagaacccgaagcagcagcactcgtcc
acgctcgagtcttacctcatcaagcccatccagaggatcctgaagtacccgctcctgctg
aaggagctgttcgccctgacggacgcggagagcgaggagcactaccacctggacgtggcc
atcaagaccatgaacaaggttgcgagtcacatcaatgagatgcagaaaatccacgaagag
tttggggccgtgttcgaccagctgattgctgaacagacgggtgagaaaaaagaggttgcc
gatctgagcatgggggacctgctcttgcacaccaccgtgatatggccaaacccaccagcc
tcactggggaagtggaaaaaggagccagaattggcagcctttgtcttcaaaactgcggtg
gtccttgtgtataaagacggctccaaacagaagaagaaacttgtaggatctcacaggctt
tcgatttatgaggagtgggaccccttccgatttcggcatatgatcccgaccgaagccctg
caggttcgagctttagcaagtgcagatgcagaagcaaatactgtgtgtgaaattgtccac
gtaaaatcagagtcggaagggaggccggagagagtcttccacctgtgctgcagctcccca
gagaaccgaaaggatttgctgaaggctgtgcattccatcctccgtgataagcaccgaaga
cagctcctgaaaaccgaaagcctcccctcgtcccagcaatacgtcccttttggaggaaaa
agattatgtgcactcaaaggggccaggccagccatgagcagggcagtgtccgccccaagc
aagtctctggggagaaggaggcggcgactggcccgaaacaggtttaccattgattccgat
gccatctccgccagcagcccggagaaagagtcccagcagccccccggtggcggggacact
gaccgatgggtagaggaacagtttgatcttgctcagtacgaggagcaagatgacatcaag
gagacagacatcctcagtgacgatgacgagttctgtgagtccgtgaagggcgccgacgtg
gacagagagctgcaggagcggcttcaggccgcctccctcggtcagcgggagaggggccgg
aaaccccgggacagccacgcgtcccgcatgacgcagctcaagaagcaagccgccctgtcg
ggcatcggaggcggcctggcgagcgcaagcgaggaagtcatttgggttaggcgtgaggac
ttcgcctcgtccaggaaactgaacacggagatctga

DBGET integrated database retrieval system