KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519729
Entry
107519729         CDS       T06036                                 

Gene name
RAF1
Definition
(RefSeq) RAF proto-oncogene serine/threonine-protein kinase
  KO
K04366  RAF proto-oncogene serine/threonine-protein kinase [EC:2.7.11.1]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray01521  EGFR tyrosine kinase inhibitor resistance
ray01522  Endocrine resistance
ray04010  MAPK signaling pathway
ray04012  ErbB signaling pathway
ray04014  Ras signaling pathway
ray04015  Rap1 signaling pathway
ray04022  cGMP-PKG signaling pathway
ray04024  cAMP signaling pathway
ray04062  Chemokine signaling pathway
ray04068  FoxO signaling pathway
ray04071  Sphingolipid signaling pathway
ray04072  Phospholipase D signaling pathway
ray04140  Autophagy - animal
ray04150  mTOR signaling pathway
ray04151  PI3K-Akt signaling pathway
ray04210  Apoptosis
ray04218  Cellular senescence
ray04270  Vascular smooth muscle contraction
ray04360  Axon guidance
ray04370  VEGF signaling pathway
ray04371  Apelin signaling pathway
ray04510  Focal adhesion
ray04540  Gap junction
ray04550  Signaling pathways regulating pluripotency of stem cells
ray04613  Neutrophil extracellular trap formation
ray04625  C-type lectin receptor signaling pathway
ray04630  JAK-STAT signaling pathway
ray04650  Natural killer cell mediated cytotoxicity
ray04660  T cell receptor signaling pathway
ray04662  B cell receptor signaling pathway
ray04664  Fc epsilon RI signaling pathway
ray04666  Fc gamma R-mediated phagocytosis
ray04720  Long-term potentiation
ray04722  Neurotrophin signaling pathway
ray04726  Serotonergic synapse
ray04730  Long-term depression
ray04810  Regulation of actin cytoskeleton
ray04910  Insulin signaling pathway
ray04912  GnRH signaling pathway
ray04914  Progesterone-mediated oocyte maturation
ray04915  Estrogen signaling pathway
ray04916  Melanogenesis
ray04917  Prolactin signaling pathway
ray04919  Thyroid hormone signaling pathway
ray04921  Oxytocin signaling pathway
ray04926  Relaxin signaling pathway
ray04928  Parathyroid hormone synthesis, secretion and action
ray04929  GnRH secretion
ray04935  Growth hormone synthesis, secretion and action
ray05010  Alzheimer disease
ray05022  Pathways of neurodegeneration - multiple diseases
ray05034  Alcoholism
ray05132  Salmonella infection
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05161  Hepatitis B
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05170  Human immunodeficiency virus 1 infection
ray05200  Pathways in cancer
ray05205  Proteoglycans in cancer
ray05206  MicroRNAs in cancer
ray05210  Colorectal cancer
ray05211  Renal cell carcinoma
ray05212  Pancreatic cancer
ray05213  Endometrial cancer
ray05214  Glioma
ray05215  Prostate cancer
ray05218  Melanoma
ray05219  Bladder cancer
ray05220  Chronic myeloid leukemia
ray05221  Acute myeloid leukemia
ray05223  Non-small cell lung cancer
ray05224  Breast cancer
ray05225  Hepatocellular carcinoma
ray05226  Gastric cancer
ray05230  Central carbon metabolism in cancer
ray05231  Choline metabolism in cancer
ray05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519729 (RAF1)
   04012 ErbB signaling pathway
    107519729 (RAF1)
   04014 Ras signaling pathway
    107519729 (RAF1)
   04015 Rap1 signaling pathway
    107519729 (RAF1)
   04370 VEGF signaling pathway
    107519729 (RAF1)
   04371 Apelin signaling pathway
    107519729 (RAF1)
   04630 JAK-STAT signaling pathway
    107519729 (RAF1)
   04068 FoxO signaling pathway
    107519729 (RAF1)
   04072 Phospholipase D signaling pathway
    107519729 (RAF1)
   04071 Sphingolipid signaling pathway
    107519729 (RAF1)
   04024 cAMP signaling pathway
    107519729 (RAF1)
   04022 cGMP-PKG signaling pathway
    107519729 (RAF1)
   04151 PI3K-Akt signaling pathway
    107519729 (RAF1)
   04150 mTOR signaling pathway
    107519729 (RAF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107519729 (RAF1)
  09143 Cell growth and death
   04210 Apoptosis
    107519729 (RAF1)
   04218 Cellular senescence
    107519729 (RAF1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107519729 (RAF1)
   04540 Gap junction
    107519729 (RAF1)
   04550 Signaling pathways regulating pluripotency of stem cells
    107519729 (RAF1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    107519729 (RAF1)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    107519729 (RAF1)
   04625 C-type lectin receptor signaling pathway
    107519729 (RAF1)
   04650 Natural killer cell mediated cytotoxicity
    107519729 (RAF1)
   04660 T cell receptor signaling pathway
    107519729 (RAF1)
   04662 B cell receptor signaling pathway
    107519729 (RAF1)
   04664 Fc epsilon RI signaling pathway
    107519729 (RAF1)
   04666 Fc gamma R-mediated phagocytosis
    107519729 (RAF1)
   04062 Chemokine signaling pathway
    107519729 (RAF1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107519729 (RAF1)
   04929 GnRH secretion
    107519729 (RAF1)
   04912 GnRH signaling pathway
    107519729 (RAF1)
   04915 Estrogen signaling pathway
    107519729 (RAF1)
   04914 Progesterone-mediated oocyte maturation
    107519729 (RAF1)
   04917 Prolactin signaling pathway
    107519729 (RAF1)
   04921 Oxytocin signaling pathway
    107519729 (RAF1)
   04926 Relaxin signaling pathway
    107519729 (RAF1)
   04935 Growth hormone synthesis, secretion and action
    107519729 (RAF1)
   04919 Thyroid hormone signaling pathway
    107519729 (RAF1)
   04928 Parathyroid hormone synthesis, secretion and action
    107519729 (RAF1)
   04916 Melanogenesis
    107519729 (RAF1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    107519729 (RAF1)
  09156 Nervous system
   04726 Serotonergic synapse
    107519729 (RAF1)
   04720 Long-term potentiation
    107519729 (RAF1)
   04730 Long-term depression
    107519729 (RAF1)
   04722 Neurotrophin signaling pathway
    107519729 (RAF1)
  09158 Development and regeneration
   04360 Axon guidance
    107519729 (RAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519729 (RAF1)
   05206 MicroRNAs in cancer
    107519729 (RAF1)
   05205 Proteoglycans in cancer
    107519729 (RAF1)
   05230 Central carbon metabolism in cancer
    107519729 (RAF1)
   05231 Choline metabolism in cancer
    107519729 (RAF1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    107519729 (RAF1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    107519729 (RAF1)
   05212 Pancreatic cancer
    107519729 (RAF1)
   05225 Hepatocellular carcinoma
    107519729 (RAF1)
   05226 Gastric cancer
    107519729 (RAF1)
   05214 Glioma
    107519729 (RAF1)
   05221 Acute myeloid leukemia
    107519729 (RAF1)
   05220 Chronic myeloid leukemia
    107519729 (RAF1)
   05218 Melanoma
    107519729 (RAF1)
   05211 Renal cell carcinoma
    107519729 (RAF1)
   05219 Bladder cancer
    107519729 (RAF1)
   05215 Prostate cancer
    107519729 (RAF1)
   05213 Endometrial cancer
    107519729 (RAF1)
   05224 Breast cancer
    107519729 (RAF1)
   05223 Non-small cell lung cancer
    107519729 (RAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107519729 (RAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    107519729 (RAF1)
  09165 Substance dependence
   05034 Alcoholism
    107519729 (RAF1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107519729 (RAF1)
   05152 Tuberculosis
    107519729 (RAF1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    107519729 (RAF1)
   05161 Hepatitis B
    107519729 (RAF1)
   05160 Hepatitis C
    107519729 (RAF1)
   05164 Influenza A
    107519729 (RAF1)
   05163 Human cytomegalovirus infection
    107519729 (RAF1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519729 (RAF1)
   05165 Human papillomavirus infection
    107519729 (RAF1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    107519729 (RAF1)
   01522 Endocrine resistance
    107519729 (RAF1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ray01001]
    107519729 (RAF1)
Enzymes [BR:ray01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     107519729 (RAF1)
Protein kinases [BR:ray01001]
 Serine/threonine kinases: TKL group
  RAF family [OT]
   107519729 (RAF1)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase RBD C1_1 Kinase-like zf-RING-like Pkinase_fungal C1_2
Other DBs
NCBI-GeneID: 107519729
NCBI-ProteinID: XP_016018184
LinkDB
Position
Unknown
AA seq 648 aa
MEHIQGAWKTISNGFGFKDAVFDGPSCISPTIVQQFGYQRRASDDGKLTDSSKTSNTIRV
FLPNKQRTVVNVRNGMSLHDCLMKALKVRGLQPECCAVFRLLHEHKGKKARLDWNTDAAS
LIGEELQVDFLDHVPLTTHNFARKTFLKLAFCDMCQKFLLNGFRCQTCGYKFHEHCSTKV
PTMCVDWSNVRQLLLFPNSTIGDSGVPALPSLTMRRMRESVSRIPVSSQHRYSTPHAFTF
NTSSPSSEGSLSQRQRSTSTPNVHMVSTTLPVDSRMIEDAIRSHSESASPSALSSSPNNL
SPTGWSQPKTPVPAQRERAPGSGSQEKNKIRPRGQRDSSYYWEIEASEVMLSTRIGSGSF
GTVYKGKWHGDVAVKILKVVDPTPEQFQAFRNEVAVLRKTRHVNILLFMGYMTKDNLAIV
TQWCEGSSLYKHLHVQETKFQMFQLIDIARQTAQGMDYLHAKNIIHRDMKSNNIFLHEGL
TVKIGDFGLATVKSRWSGSQQVEQPTGSVLWMAPEVIRMQDNNPFSFQSDVYSYGIVLYE
LMTGELPYSHINNRDQIIFMVGRGYASPDLSKLYKNCPKAMKRLVADCVKKVKEERPLFP
QILSSIELLQHSLPKINRSASEPSLHRAAHTEDINACTLTTSPRLPVF
NT seq 1947 nt   +upstreamnt  +downstreamnt
atggagcacatacagggggcctggaagacgatcagcaatggttttggattcaaagacgca
gtgttcgatggccccagctgcatttcccccacaatagttcagcagtttggctaccagcgt
cgggcgtcagatgatggcaaacttacggactcttctaagacaagcaatactatccgtgtt
ttcttgccaaacaagcaaagaacggtggtcaatgtacgaaatggaatgagcttgcatgac
tgccttatgaaagcactcaaggtgaggggcctgcaaccggagtgctgtgcagtgttcaga
cttctccacgaacacaaaggtaaaaaagcacgtttagattggaatactgatgctgcctcg
ttgattggagaagagcttcaagtagatttcctggatcatgttcccctcacaacacacaat
tttgctcggaagaccttcctgaagcttgccttctgtgacatgtgtcagaagtttctgcta
aatggatttcgatgtcagacttgtggctacaaatttcacgagcactgtagcaccaaagta
cctactatgtgtgtggactggagtaatgtcagacaactcttattgtttccaaattccacc
attggtgacagtggggtcccagcactgccttctttgacaatgcgccggatgcgagagtct
gtttcccggattcctgttagttcccagcacagatactccacacctcacgccttcacattc
aacacctccagcccttcctctgaaggttccctctcccagaggcagaggtcgacgtccaca
cctaatgtccacatggtcagcaccaccctgcctgtggacagcaggatgattgaggatgca
attcgaagtcacagtgaatcagcctcaccttcagccttgtccagcagccccaacaatctg
agcccaacaggctggtcacaacccaaaacccctgtgccggcacagagagagcgggcacca
ggatccgggagccaggaaaaaaacaaaattaggcctcgtggacagagagattcaagctat
tactgggaaatagaagccagtgaagtgatgctctcgactcggattgggtcaggctccttt
ggaactgtttataagggcaagtggcatggagacgttgcagtaaagattctaaaggttgtc
gatcctacaccagaacagttccaggccttcaggaatgaggtggctgtcctacgcaaaaca
cggcacgtgaacatcctgcttttcatggggtacatgacaaaggacaacctggcgattgtg
acccagtggtgtgagggcagcagcctctacaaacacctgcatgtccaagagaccaagttc
cagatgttccagttgattgacattgcccggcagacggctcagggaatggactatttacat
gcaaagaacatcatccacagagacatgaaatccaacaatatatttcttcatgaaggcttg
acggtgaaaattggagattttggtttggcaacagtaaagtcgcgctggagtggttctcag
caggttgaacaacccaccggctctgtcctgtggatggccccagaggtgatccgaatgcaa
gataacaaccccttcagcttccagtcagatgtctactcctatggcattgtgctgtatgag
ctcatgacaggggagctaccttattcccacatcaacaaccgagatcagatcatcttcatg
gtgggccgaggatatgcctctccagaccttagtaagctatacaagaactgccccaaagca
atgaagaggctagtagccgactgtgtgaagaaagttaaggaagagaggcctctttttccc
cagatcctgtcttccatcgagctgctccaacactctctaccgaaaattaaccggagcgct
tctgagccatccctgcatcgggcggctcacaccgaggatatcaacgcctgcacactgacc
acgtcccccagactgcctgtcttctag

DBGET integrated database retrieval system