KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519731
Entry
107519731         CDS       T06036                                 

Gene name
PPARG
Definition
(RefSeq) peroxisome proliferator-activated receptor gamma isoform X1
  KO
K08530  peroxisome proliferator-activated receptor gamma
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray03320  PPAR signaling pathway
ray04152  AMPK signaling pathway
ray04211  Longevity regulating pathway
ray04380  Osteoclast differentiation
ray04714  Thermogenesis
ray05016  Huntington disease
ray05200  Pathways in cancer
ray05202  Transcriptional misregulation in cancer
ray05216  Thyroid cancer
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    107519731 (PPARG)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    107519731 (PPARG)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107519731 (PPARG)
  09149 Aging
   04211 Longevity regulating pathway
    107519731 (PPARG)
  09159 Environmental adaptation
   04714 Thermogenesis
    107519731 (PPARG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    107519731 (PPARG)
   05202 Transcriptional misregulation in cancer
    107519731 (PPARG)
  09162 Cancer: specific types
   05216 Thyroid cancer
    107519731 (PPARG)
  09164 Neurodegenerative disease
   05016 Huntington disease
    107519731 (PPARG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ray03000]
    107519731 (PPARG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:ray03310]
    107519731 (PPARG)
Transcription factors [BR:ray03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    107519731 (PPARG)
Nuclear receptors [BR:ray03310]
 1. Thyroid hormone like
  1C. Peroxisome proliferator-activated receptor (PPAR)
   107519731 (PPARG)
SSDB
Motif
Pfam: PPARgamma_N zf-C4 Hormone_recep Tmemb_55A
Other DBs
NCBI-GeneID: 107519731
NCBI-ProteinID: XP_016018186
LinkDB
Position
Unknown
AA seq 505 aa
MGETLGDSLIDPESDSVADTLSASTSQEITMVDTEMPFWPTNFGISSVDLSVMDDHSHAF
DIKPFTTVDFSSISTPHYEDIPFARADPMVADYKYDLKLQEYQNAIKVEPASPPYYSEKT
QLYNKPHEEPSNSLMAIECRVCGDKASGFHYGVHACEGCKGFFRRTIRLKLIYDRCDLNC
RIHKKSRNKCQYCRFQKCLAVGMSHNAIRFGRMPQAEKEKLLAEISSDIDQLNPESADLR
ALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKIKFKHITPLQE
QSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGVHEIIYTMLAS
LMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDTDLAIFIAVII
LSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDLRQIVTEHVQL
LQVIKKTETDMSLHPLLQEIYKDLY
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgggcgaaactctgggagattctcttattgacccagaaagtgattccgtcgctgataca
ctgtctgcaagcacttcacaagaaattaccatggttgacacagagatgccattttggcct
accaacttcggaatcagctccgtggatctttctgtaatggacgaccactcccacgccttt
gacatcaagcccttcaccaccgttgatttctccagcatttctaccccacactatgaagac
attccatttgcaagagctgacccaatggttgctgattataagtatgacctgaagctccaa
gagtaccaaaatgcaatcaaagtggagcctgcatccccaccttattattctgaaaagact
cagctgtacaataagcctcacgaggagccttccaactccctcatggcaatcgaatgccgt
gtctgtggagataaagcttctgggttccactatggagttcatgcttgtgaaggatgtaag
ggtttcttccggagaacaatcagattgaagcttatttatgataggtgtgatcttaactgt
cggatccacaaaaaaagtagaaataaatgtcagtactgtcggtttcagaaatgccttgct
gtggggatgtctcataatgctatcaggtttgggcggatgccacaagctgagaaggagaag
ctgttggcagagatctccagtgatatcgaccagctgaacccagagtctgctgatctacgg
gccctggcaaaacatttgtatgactcatacataaagtccttcccgctgaccaaagcaaag
gcgagggccatcttaacaggaaagacaacagataaatcaccgtttgttatctatgacatg
aattctttaatgatgggagaagataaaatcaagttcaaacacatcacccccttgcaggag
cagagcaaagaggtagccatccgcatttttcaggggtgtcagtttcgctcagtggaagct
gtgcaagagatcacagagtatgccaaaagtattcctggctttgtaaaccttgacttgaat
gaccaagtaactctcctaaaatatggcgtccatgagatcatttacacgatgctggcctcc
ttgatgaataaagatggggttctcatatcagagggccaaggattcatgacaagggagttt
ctaaagagcctgagaaagccctttggtgactttatggagcccaagtttgagtttgctgtg
aagtttaatgcactggaattagatgacaccgacttggcaatatttatagccgtcattatt
ctcagtggagaccgcccaggtttgctgaatgtgaagcccattgaggacatacaagacaac
ttgctgcaagccttggagctccagctcaagctgaaccaccccgagtcctctcagctcttt
gccaagctgctccagaaaatgacagacctcagacagattgtaacagaacatgtgcagcta
ttgcaagtaataaagaaaacagagacagacatgagtcttcacccactcctacaggaaata
tacaaggacttgtattag

DBGET integrated database retrieval system