KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519744
Entry
107519744         CDS       T06036                                 

Gene name
PCLO
Definition
(RefSeq) LOW QUALITY PROTEIN: protein piccolo
  KO
K16882  protein piccolo
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04911  Insulin secretion
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    107519744 (PCLO)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ray04131]
    107519744 (PCLO)
Membrane trafficking [BR:ray04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Others
    107519744 (PCLO)
SSDB
Motif
Pfam: zf-piccolo C2 PDZ FYVE_2
Other DBs
NCBI-GeneID: 107519744
NCBI-ProteinID: XP_016018210
LinkDB
Position
Unknown
AA seq 5064 aa
MGNEASLEGEGLPEGLAAAAAAAAGGGAGGAGSPLHSVIPAGMEADLSQLSEEERRQIAA
VMSRAQGLPKGSVPPAAAEPPSMHRKQELDSSHPPKQPGKPPDLGRPAQPGLSKSRTTDT
LRSEQKLPGRSPSTISLKESKSRTDFKEEHKSSMMPGFLSEVNPLSAVSSVVNKFNPFDL
ISDSDASQEETAKKQKIAQKEQGKPEGITKPPSQQSPKPIPKQQGPVRAPPQQDSSPKSM
SSQQSEKVKSQPPETGKQVQGLTQAPQTDQTKLPLQRDTTRPQTKQSDTVRGEPVKPSLQ
NPSKPPTQQASPGKPPAQQPGPEKLSTTQSGPSKPSAQQPGPVKALAQQPGTAKSSAQQL
TTKPPAQPPGTTKPAAQQPGPKSPAQPPGATKPPAQQLGTPKPPAHQPGPQSAAQPPGPT
KVSAQQVVPVKSLTQQSGTGKTPVQQPGPTKPPPQQPGPTKPPPQQPGPAKPPTQQPSPA
KPSAQQSTKPVSQTGAEEPLQPPTFPSAAQTPVQGLPKTICPLCKTTELLLHVPEKANFN
TCTGCQTTVCSLCGFNPNPHLTEIKEWLCLNCQMQRALGGDLAPIPSSPQPTPKTTAVLP
TSTVSKPSPQSEQISSKKDTAPKQDISKTPESRKPPPLVKQPTLHGSPPVTAKQPSVAES
SLKPAPPKEPSVPSEQAKAPIAGEKPKQPKTVKPAADIVSLSSTATKPDIPRSKVQSQDQ
EKTIPPLKIDSAKPSQSFPPTGGKVTPMDSEVIPRPASDSKIISHPGPSMESKGQKQADP
VQKREELKKAQTKMTPKPDAKPMPKGTPTPPGPRPTTGQTVPPSQQPSKPQEQSRRFSLN
LGSITDAPKSQPTTPQETVTGKLFGFGASIFSQASNLISTAGQPGSHSQSGPGAPTKQVP
PPSQLPTSQGSAKSTGQVPPAPAKVIPVKKETKTPVAEKIEPKAEQVPTVKRTETEKKPL
PIKDSTPSTAETQQAALPPKLEKTPKPEPTCPLCKTELNTGSKDPPNFNTCTECKNQVCN
LCGFNPTPHLTEIQEWLCLNCQTQRAISGQLGDMGKMPSTPSGPKASPMPVPTEQPPEKI
AMPAQDKVKKKEQEVKTEAEKIIPEKAKETPLIEKMPPRITTDQKQEESKQEKDKALAPQ
EKKPPPEDKKTLPEEKKPPLEEKKPTPEDKKLPPGPKTSALEEQQKHDLLKTQVQIAEGK
PEGTVASQAVQEKKQPQTKVEDLPSRMPQSFPERDDGTTQKIKEQPQAACTAQPGQVEPG
KEKTEKEDDKSDTSSSQQPKSPQGLSDTGYSSDGISGSLGEIPSLIPSDEKDLLKGLKKD
SFSQESSPSSPSDLAKLESTVLSILEAQASTLVEEKSDRKTQPQEVSPEQPMDQQKTQSL
TETLETAISEEKLKESQEKDTFKKDSQQGIPSRKDHKEKSEFVDDIATRRQPYDSVEDSS
ESENSPVPQRKRRTSVGSSSSDEYKQDDSQGSGEEEDFIRKQIIEMSADEDASGSEDEEF
IRNQLKEISSIESQKKEETKGKGKVTTGKHKRLTRKSSTSFDDDAGRRHSWHDEDDETFD
ESPELKYRETKSQESEELVVAGGGGLRRFKTIELNSTIADKYSAESSQKKAALYFDEEPE
LEMESLTDSPEDRSRGEGSSSLHASSFTPGTSPTSVSSLDEDSDSSPSHKKGESKQQRKA
RHRSHGPLLPTIEDSSEEEELREEEELLKEQEKQRELEQQQRKSSSKKSKKDKDELRAQR
RRERPKTPPSNLSPIEDASPTEELRQAAEMEELHRSSCSEYSPSIESDPEGFEISPEKII
EVQKVYKLPTAVSLYSPTDEHSIMQKEGGQKALKSAEEIYEEMMQKTHKYKGFPAANERD
EMFEKEPLYGGMLIEDYIYESLVEDTYNGSVDGSLLTSQEDENGFIQQRGREQKIRLPEQ
IYDDPMQKITDLQKEFYELESLHSVMPQEDIVSSSYIIPESHEIVDLGSMVTSTSEEKKL
LDADAAYEELMKRQQMQLTPESSPTQPPIRDDMTESTVDFDRVPDASLTSSILSGASLTD
STSSATLSIPDVKITQHFSTEEIEDEYITDYTREIQEIIAHESLILTYSEPSEGATSVPP
SDTPSLTSSVSSVCTTDSSSPITTLDSITTVYTEPVDIVTKFEDSEEISSSTYFPGSIID
YPEEISISVDQTMIQDGRTSADHIVISLPDIAPPILESIETEPEGLIADTISTDLSITEK
DPVKKTKKETENGIILEVLEAYRDKRSESETELTKISLSETVFDQPPSVIAFPMKEQVST
THFILGEAFGQAKPASQLPSGSLPTSSFPTKTRPFLRSSSLDISAQPPPPPPPXPPPPPP
PLTSPXPPLPPPTSPKPAIHPKKKLSSTAPTTAATPLVDTVTTVETTDVPRSNGLPVTKI
CTTAPPPVPPKPSSIPSGLVFTHRPEPSKPPIAPKPAVPQLPVTTQKPTDTHPKPTGLPL
TSNMTLNLVTSADYKLPSPTSPLSPHSNKSSPRFSKSLMETYVVITLPSEPGTPTDSSAS
QAITSWPLGSPPKDLISFEPVFSVVPSMTAAEISHSTEQSLYISGALETFSAIPVTTLSS
FEAAPTSVTQLLTTEVSKAKVSAARSIVPSVGLSSISITIPPEPLALDNLHLEKHQHKEN
GKLQLAGDAIDLRTIPKVEVKVTEKCMDLSTSTMDVKRPTTTSEAYGRQISAVQPTIINL
SATSSVVTPISLVTETMTVVTCTTSASHTTGTESLVGIEHATTTPLQLTTSKLTEPLYRI
PSGQAFPTGRQEAPINLSLGTSAHAVTLATTKPVTAPPVSVTNGWTDSTTSQGVTDGEAV
DLSTTKSHRTVVTVDESASGVVTKIIEDDEKPVDLTAGRRAVCCDVVYKLPFGRSCTAQQ
PATTLPEDRFGYRDDHYQYARSGPYGYRGIGGMKPSMSDTNLAEAGHFFYKSKNAFDYSG
ETDAAVDLTSGRITTGEVMDYSSKTTGPYPETRQVISGVGISTPQYSTTRMTPPPGSQYS
VGSVLRSSNGVVYSSVATPIPSTFAITTQPGSIFSTTVRDLSGVHTTDAMTSLSALHQSQ
PMPRSYFLTTGASETDIVVTGIDISASLQTITMETLTAETIDSVPTLTTASEVFSEVGDE
SAILIVPEEDKQQQQLDLERELLELEKIKQQRFAEELEWERQEIQRFREQEKIMVQKKLE
ELQSMKQHLLYQQEEERQAQFIMRQETLAQQQLQLEQIQQLQQQLHQQLEEQKIRQIYQY
NYDPSGTASPQTTTEQAMLESQYGAPEGGQFWATEDTTTTASAVVAIEIPQSQGWYTVQS
DGVTQYIAPPGILSTVSEIPLTDVVVKDEKQPKKRSSGAKIRGQYDEIGENMADDPRCFR
KIVDSGVQTDDEDAADRSYVSRRRRTKKSVDTSVQTDDEDQDEWDMPTRSRRKARVAKYG
DSTTEAEKTKPLSKVSSIAVQTVAEISVQTEPVGTIRTPSIRARVDAKVEIIKHISAPEK
TYKGGSLGCQTEADSDTQSPQYLSATSPPKDKKRPTPLEIGYSSHLRADSTLQLAPSPPK
SPKVLYSPISPLSPGKALESAFVPYEKPLPDDISPQKVLHPDMAKVPPPSPKTAKMMQRS
MSDPKPLSPTADESSRAPFQYTEGYTTKGSQTMTPSGIQKKVKRTLPNPPPEETSTGTQS
TYSTMGTVSRRRICRTNTMARAKILQDIDRELDLVERESAKLRKKQAELDEEEKEIDAKL
RYLEMGINRRKEALLKEREKRERAYLQGVAEDRDYMSDSEVSSTRPTRIESQHGIERPRT
APQTEFSQFIPPQTQTESQPVPPTSPYTQYQYSSPALPTQAPTPYTQQSHFQQQTLYHQQ
VSPYQTQPTFQAVATMSFTPQAQSTPTPQPSYQLPSQMMVIQQKPRQTTLYLEPKITSNY
EVIRNQPLMIAPVSTDNTYAVSHLGSKYNSLDLRIGLEERSSMVSSPISSISADSFYADI
DHHTPRNFVLIDDIGEITKGTAALSTAFSLHEKDLSKTDRLLRTTETRRSQDVTDFLAPL
QTSSRMHSYVKAEEDPMEDPYELKLLKHQIKQEFRRGAESLDHLAGLSHYYHADTSYRHF
PKSEKYSISRLTLEKQAAKQLPAAILYQKQSKHKKSLIDPKISKFSPIQESRDLEPDYSS
YMTSSTSSIGGISSRARLLQDDITFGLRKNITDQQKFMGSSLGTGLGTLGNTIRSALQEE
ADKPYSSGSRSRPSSRPSSVYGLDLSIKRDSSSSSLRLKAQEAEALDVSFSHASPSSRTK
PTSLPISQSRGRIPIVAQNSEEESPLSPVGQPMGMARAAAGPLPPISADTRDQFGSSHSL
PEVQQHMREESRTRGYDRDIAFIMDDFQHAMSDSEAYHLRREETDWFDKPRESRLENGHG
LDRKLPERLVHSRPLSQHQEQIIQMNGKTVHYIFPHARIKITRDSKDHTVSGNGLGIRIV
GGKEIPGHSGEIGAYIAKILPGGCAEQTGRLIEGMQVLEWNGIPLTSKTYEEVQSIISQQ
SGEAEICVRLDLNMLSDSENSQHLELHEPTKAVDRAKSPGVDPKQLAAELQKVSLQQSPL
VLSSVVEKGSHVHSGPTSAGSSSVPSPGQPGSPSVSKKKHSSSKPTDATKVVSHPITGEI
QLQINYDLGNLIIHILQARNLVPRDNNGYSDPFVKVYLLPGRGQVMVVQNASAEYKRRTK
YVQKSLNPEWNQTVIYKSISMEQLKKKTLEVTVWDYDRFSSNDFLGEVLIDLSSTSHLDN
TPRWYPLKEQTESIDHGKSHSSQSSQQSPKPSVIKSRSHGIFPDPSKDMQVPTIEKSHSS
PGSSKSSSEGHLRSHGPSRSQSKTSVTQTHLEDAGAAIAAAEAAVQQLRLQPTKPTNHRP
AESSVSTGSSGSSFGSGYSVDSEGSSSTAGETNLFPIPRIGKMGQNGQELIKQPGVGVGL
ADTEVKTQVMGEIKIALKKEMKTDGEQLIVEILQCRNITYKFKSPDHLPDLYVKLYVMNI
STQKKVIKKKTRVCRHDREPSFNETFRFSLSPAGHSLQILLFSNGGKFMKKTLIGEACIW
LDKVDLRKRIVNWHKLLVSPTQTH
NT seq 15195 nt   +upstreamnt  +downstreamnt
atgggcaatgaggcgagcttggaaggagaagggctccctgaagggctggcggcagcagcg
gcagcggccgccggaggaggggctggcggggcggggagccccttgcactcggtgatcccg
gcgggcatggaggcggatctgagccagctgagcgaagaagagaggagacagatcgccgct
gtcatgtcaagggcgcaggggctgcccaagggaagcgtcccccctgccgctgcggagccg
ccttccatgcacaggaaacaagagttggatagtagtcaccctccaaagcaaccaggaaaa
ccgccagacctcgggcgtccagctcagcctggtctcagtaaaagtagaactacagacact
ttgaggtcagagcagaaattgcctggaaggagtccttccactattagcttgaaagaatca
aagtctagaactgattttaaggaagagcacaagtctagtatgatgcctggcttcctctca
gaggttaatcctttaagtgctgtttcctctgttgtaaataaattcaatccttttgatttg
atatcggactctgatgcatcccaggaagaaaccgccaagaaacaaaaaatagctcagaag
gaacaaggaaaacctgaaggaatcacaaaaccaccatcacaacagtcacccaagcctatt
cctaagcagcaaggacctgtgagggccccacctcagcaggatagctctcctaaatcaatg
tcttctcagcaatcagaaaaagttaaatcacaacctccagagacaggaaagcaagtccag
gggcttacccaggctcctcagacagaccagacaaaattgccacttcaaagggatacaacc
aggcctcagactaaacagtcagacacagtaaggggagaaccagtcaaaccctcactgcaa
aacccatctaaaccaccgactcagcaagcaagtcctggaaaacctccagcccagcagcct
ggaccagaaaaactttccacaacacagtctggaccttcaaagccctcagctcagcaacca
gggccagtgaaggccctagctcaacagccagggacagcaaaatcttcagctcaacagctg
acaacaaagcccccagcccagccacctgggacaacaaagccggcagctcagcagcctggg
ccaaagtctccagctcagcctccaggggcaacaaagccacctgcccagcagctgggtaca
ccaaaacctccagctcaccaacctgggccacagtctgcagctcagccacctgggcctaca
aaggtttcagcacagcaggttgtgccagtgaagtctctgactcagcagtctgggacagga
aagactcctgttcaacaacctggcccaacaaaaccccctcctcaacagcctggcccaaca
aaaccccctcctcaacagcctggcccagcaaagcccccaactcaacagcctagcccagca
aaaccctcagctcagcaatctacaaaacctgtaagccaaacaggagctgaggagcctctg
cagccaccgacttttccatctgcagcacagactccagtacaaggcctccctaaaaccatc
tgtcctctttgcaaaaccactgaacttctgttgcatgttccagaaaaggccaattttaac
acatgcactgggtgtcaaaccactgtctgtagcctctgtggttttaatcccaatcctcat
ttaaccgagataaaagagtggctctgtttaaactgtcagatgcaaagagctcttggaggt
gatctggctccaattccatcatcaccccagcccacaccgaagactaccgcagttcttcct
acatcaacagtgagcaaaccatccccacagtcggagcagatttcttcaaagaaagatact
gcacccaaacaggatatctcaaagacacctgagtccagaaagcccccaccactggtgaaa
caaccaacccttcatggttctccccctgtcacagccaagcagccttctgtggcagagtcc
tcattgaagccggcccctcccaaagagccttctgtcccatccgagcaggccaaggccccc
atagctggtgaaaaaccaaagcagcccaagacagtaaagccagccgcagacattgtgtct
ttatcgtcaacggcaacaaaacctgatattccgagatccaaagtacagtcacaggatcaa
gagaaaacaatcccacctctaaaaatagactcggccaaaccttcacaaagttttccacca
acaggaggaaaggtcaccccaatggactctgaagtcatacctcgacctgcatcagattcg
aaaattatttcacatcctgggcctagtatggagagcaaaggtcaaaaacaagctgatcca
gttcaaaagagggaagaactcaagaaagcacaaaccaaaatgactcctaaaccagatgcc
aagccaatgccaaaagggacaccgacacctccaggccctcgacctaccactggccaaact
gtgcccccatctcaacagccatcgaagcctcaggagcagtcgagacgtttcagtctgaat
ctgggaagtattaccgatgcccccaaatcacagcccacaactcctcaagaaactgtgact
gggaaactctttggttttggagcatcgatcttcagccaagcatctaatctaatttccaca
gcaggccagcccggatctcattcacaaagtgggccaggggccccaaccaaacaagtccct
cctccttcacagctgcctacttctcaggggtcagccaagtctacaggtcaggtaccacca
gcacctgcaaaggttatacctgtgaaaaaggaaacaaaaactccagtagctgaaaaaata
gagcccaaagctgaacaagttccaacagtaaaaagaacagaaacagaaaagaagcctctt
cctattaaggatagcacaccttcaacagctgagactcaacaggctgcccttcctcccaaa
ctggagaaaactcccaaaccagaacccacctgtcctctctgcaaaactgaactcaacaca
ggttctaaggatcctcctaatttcaacacttgcactgaatgcaagaatcaagtatgtaat
ctctgtggatttaaccctacaccacatttaactgagattcaagaatggctttgtttaaat
tgccaaacccagagagcaatatcaggacagcttggtgacatgggcaaaatgccatccaca
ccatcagggccaaaagcgtctcctatgcctgtaccaacagaacaaccacctgagaaaata
gcaatgcctgctcaagataaagtgaaaaagaaggaacaagaagtaaaaacagaagctgaa
aaaattattccagaaaaagcgaaagaaacacctttaattgaaaaaatgcctcccaggata
accacagatcaaaaacaagaagaaagtaaacaagagaaagacaaagctttagcccctcaa
gaaaagaagccacctcctgaagacaaaaaaacactcccagaagaaaaaaagccacctctt
gaagaaaaaaaaccaacccctgaagacaaaaagttaccgccaggaccaaaaacatcagct
ctagaggaacaacagaaacatgacttacttaaaactcaagtacaaattgctgaaggaaag
cctgaaggcacagtggcttcacaggcagtgcaagaaaagaagcaaccacaaaccaaggtg
gaagatttaccttctaggatgcctcagagctttcctgagagagacgatgggacaactcaa
aagataaaagaacaaccacaagcagcatgcacagcacagcctggtcaggtggaacctggg
aaggaaaaaacagaaaaggaagatgacaaatcagacacttcaagttctcaacagccgaaa
agcccacaaggtctgagtgacacaggatattcttcagatggcatttcaggttcacttggt
gaaattccaagtcttattccaagtgatgaaaaagatttgctcaagggactcaaaaaggac
tctttttcacaagaaagcagcccttccagcccctcagatttggctaagttagaaagtaca
gtcctgtccatcttggaagcccaggcaagtacgcttgttgaagaaaagtcagataggaaa
acacagcctcaggaggtttctcctgagcagcctatggatcaacagaaaactcagagttta
actgaaacactggaaactgcaatttcagaagagaagttgaaagagagtcaagaaaaagat
acttttaaaaaagatagccaacaaggcattccttccagaaaggaccataaagagaagtct
gagtttgttgatgacatagctacaagaagacagccttatgattcagtcgaagacagtagt
gagagtgaaaactcacctgttccacaaagaaaacggagaacgagtgttggttcatcaagc
agtgatgagtataaacaggacgatagtcaaggatcaggtgaagaggaggactttattcga
aaacaaataatagaaatgagtgctgatgaagatgcttcaggttctgaagatgaagagttc
attaggaatcagctgaaagaaattagtagtattgagagccaaaagaaggaagaaacaaaa
gggaaagggaaggtaacaacggggaaacacaaacgactaactcgaaaaagtagtacaagc
tttgatgatgatgcagggagacgccattcgtggcatgatgaagatgacgagacatttgat
gaaagtcctgaacttaaatacagagaaactaaaagtcaagagagtgaagaacttgtagtt
gctggaggaggagggctacgaaggtttaaaacaattgaactcaacagcacaatagctgat
aaatattcggcagagtcatcacagaaaaaagcagcattgtattttgatgaagagccagaa
ttagaaatggaaagcctgacagactctccagaagataggtcaaggggggaaggatcttct
agtcttcatgcttccagcttcactcctggcacatctcctacatcagtgtcctcacttgat
gaagacagtgacagtagcccaagtcacaaaaaaggagagagcaaacagcaacgcaaagct
cggcacagatcacatggtcctcttttacctactattgaagattcttcagaggaagaagaa
ctgagagaggaagaagaattattaaaggagcaagaaaagcagcgggaattagaacagcaa
caaagaaagagttctagtaaaaaatcaaagaaagacaaagatgaacttcgagctcagaga
aggagggaaagaccaaagacaccacctagtaatctctcccccatcgaagatgcatctcca
actgaagaattacgtcaggctgcagaaatggaggagctccatcgatcttcttgttctgaa
tattcacctagcatagagtccgatccagagggttttgaaataagcccagaaaaaataata
gaagtgcaaaaagtgtataaattgcccacagcagtgtctttatactcaccaacagatgag
cattctattatgcagaaagaaggtggccaaaaggcattaaaaagtgccgaggagatatat
gaagaaatgatgcaaaaaacccacaaatataagggttttccagctgcaaatgaacgagat
gaaatgtttgaaaaagagcctttgtatggagggatgttaatagaggattacatttatgaa
tctttagtagaggacacatacaatggttcggtagatggtagtctgctaacaagtcaagaa
gatgaaaatggatttattcagcagagaggaagagagcaaaaaataagacttccagaacag
atttatgatgatcctatgcagaaaattacagatctccagaaagagttttatgagttagaa
agcttacattctgtcatgcctcaagaagacattgtttcaagttcttatatcatcccagaa
agccatgagatagtggatctgggtagtatggtaacttctaccagtgaagaaaaaaaatta
ttagatgctgatgctgcatatgaagaacttatgaagaggcaacagatgcagctaacacct
gaatccagtccaactcagccccctatcagggatgacatgacagagtccactgtggacttt
gatagggtgcccgatgcatcgctgacatcaagtattctttcaggagcatctcttacagat
tcgaccagcagtgcaacactctctatcccagatgttaaaataacccaacatttttcaaca
gaggaaatagaagatgaatatataactgattatacaagagaaattcaagagataattgcc
catgaatctctgattttgacttactctgagccttcagaaggtgctacatctgtgccacct
tctgacacaccttccctcacgtcatctgtttcttcagtttgtaccactgatagctcctca
cccattactaccctggacagcataacaacagtttatacagagccagtagacatagtaact
aaatttgaagattctgaggagatttcttcatcaacatattttccaggcagcattatagac
tatccagaagaaataagtatatctgtagatcagactatgatacaagatggtagaactagt
gctgatcatattgttatttccttacctgatatagctcctcctatcttagagtctatagaa
actgagcctgaaggactaattgctgacactatttccactgacttatctataactgaaaaa
gacccagtgaagaaaaccaagaaggaaactgagaatggaattattctggaagttttagaa
gcttacagagataaaaggagtgagtctgagactgaactaacaaaaattagcttatctgaa
actgtgtttgatcaaccaccttctgtaatagcctttccaatgaaggagcaggtttcaact
acacactttatattgggagaagcctttggtcaagcaaaacctgcatctcagttaccatct
ggcagtcttcctacttcctcttttccaactaagactcgtccattccttcgtagttcttct
ttggacatatcagctcaacctcctcccccaccccctcctncccctccgcctcctccccca
cccctcacctctcctnccccaccacttcctccaccaacctcacctaaaccagccattcat
cctaaaaaaaagttaagcagtacagctccaactactgcagctacacctctagttgacact
gttaccactgtagagaccacagatgttccaaggagtaatgggttacctgtaacaaaaata
tgtaccactgcaccacctcctgttcctcctaagccatcttcaattccatctggacttgta
tttacgcatagacctgagccaagcaaacctcccattgcccctaaaccagcagttcctcag
cttccagtaactacacaaaaaccaacagatacacatcctaagccaacaggtctaccatta
acttcaaatatgacattaaatttagtcacttcagcagattataaattgccttcccctacc
tccccactttctcctcactctaacaagtcctcaccaagattttccaaatccctcatggaa
acttacgtggttatcacattgccatctgaacctgggactccaacagattcttcagctagt
caagcaattaccagttggcccctgggatcacctcctaaagatctgatatcatttgaacca
gtgttttctgtagttccttctatgacagctgcagaaatttcacattcaacagaacagagc
ctgtacatctcaggagctttggagacattctctgctatccctgtcacaacactgtcttca
tttgaagcagccccaacttcagttacgcagcttctcacaactgaagtgtctaaggctaag
gtttcagcagccagaagtatagtccctagtgttggtctcagcagcatctctataacaatt
cctccagagcctcttgctttagataacctacatttagagaagcatcagcataaagaaaat
ggaaagttacaacttgctggtgatgccattgatttgcgtacaataccaaaagtggaagtt
aaagtaactgaaaaatgtatggatctttccacttctacaatggatgtgaaaaggccaact
acaacaagtgaagcttatgggagacaaatcagtgctgtccaacccactattataaatctc
agtgcaacttcatcagtagtgactccaatatccctggtcaccgagacaatgactgttgtc
acgtgcacaactagtgcaagtcacaccacaggcacagaaagtctagtgggcatagaacat
gcaacaacaacaccacttcagcttactacatcaaagcttaccgagcccctatacaggata
ccaagtggccaggcctttcctacaggtaggcaggaagcaccaataaacttatctttaggt
acttcagcacatgcagtgacactggctactacaaagcctgttactgcacctcctgtcagt
gtcacgaatggatggactgatagcaccacatcccaaggggtcactgatggggaagcagtg
gatctcagtacaacaaagtctcacagaactgttgtaacagtggatgaatctgcttccggt
gtggtgaccaaaataatagaagatgatgagaaacctgttgatctgactgcaggaagaaga
gctgtgtgctgtgatgtggtttataagttaccttttggaaggagctgcacagcacagcag
cctgcaactactcttcctgaggaccgttttggttatagggatgaccactatcagtacgct
cgatcagggccatatggttatagagggattgggggaatgaaaccttccatgtctgacact
aatctagcagaagctggacattttttctataaaagtaagaatgcttttgattattctgga
gaaactgatgcagcagtagatctaacttcagggagaattactacaggtgaggtaatggat
tattcaagcaagactacaggtccatatccagaaacacgacaagtcatttcaggagtgggg
attagtaccccacagtattccacaacaagaatgactccgcctccaggatcccagtatagt
gtggggagtgttttgaggtcatctaatggtgttgtctattcttcagtggcaactccaatt
ccttccacatttgctatcaccactcaacctggctccattttcagcaccacagtgagagat
ttgtctggtgtgcacacgactgatgcaatgacttcattatccgccctgcaccagagccag
ccaatgcctagatcatatttcctaacaacaggtgcatctgaaacagacattgtagtaact
ggtattgatatcagtgccagtttgcaaactattactatggaaactcttactgctgagaca
atagactcagttcccactttaaccacagcatctgaagtgttttctgaagtgggagatgaa
agtgccattttaattgtccctgaagaagataaacaacagcagcagctagacttggagcgt
gagctcttggaactggagaaaattaagcaacaacgttttgctgaggaattagagtgggaa
cgccaagaaatacaaaggttccgagaacaggaaaagatcatggttcagaaaaagctggag
gagctgcagtctatgaagcaacaccttctttatcagcaagaagaagagcgtcaagcccag
ttcataatgaggcaggagacattagctcagcaacagttacagctggagcagatccagcag
ctgcaacaacagcttcaccaacagcttgaggagcagaagattcgccagatctatcagtat
aactatgatccttcaggaactgcttctccacaaaccactacagagcaagcaatgttggaa
agtcagtatggtgccccagaaggtggtcagttttgggcaaccgaagatacaaccaccaca
gcgtcagccgttgtggcaattgaaataccacaaagccaaggatggtacacagttcagtct
gatggtgttactcagtatattgccccgcctggcatcctgagtactgtttcagaaatacct
ttaacagacgttgttgtaaaagatgaaaaacaacccaaaaaaagaagttctggagctaaa
atccggggacagtatgatgagataggggaaaatatggcggatgatccccgctgttttaga
aagatagttgacagtggtgtacagactgacgatgaagatgcagcagatcggagttacgtg
agtaggagaaggagaacgaaaaagagtgtcgatacgagtgtccaaactgatgatgaagat
caggatgaatgggacatgcctactagatcaaggagaaaggctcgtgttgcaaaatatggt
gacagcactacagaggctgagaagaccaaacccctttccaaagtctccagtatagcagtt
caaacagtagcagagatatctgtgcaaactgaaccagttggaaccatacgaacgccttca
attcgggcacgcgtggatgccaaggtagaaataattaaacacatttcagcacccgaaaag
acttacaaagggggcagtttaggatgtcaaacagaagcagattcagacacacagagtcct
caatatctgagtgccacatctccacccaaagacaagaaacgcccaacacctttagagatt
ggttattcatctcaccttcgagcagattccacactacagctggctccttccccacccaaa
tctccaaaagtcctttattcacccatctcaccactttcaccaggcaaagccttagaatca
gcctttgtaccttatgaaaaacccctccctgatgatataagtccacagaaagtactgcat
ccagatatggctaaagttcccccaccgagtcctaagacagccaagatgatgcagcggtcc
atgtccgaccccaagcctctgagtccaacagcggacgaaagttccagggctccttttcag
tataccgagggctacacgacgaaaggttctcaaaccatgacaccctctggcatccagaaa
aaagttaagagaactctgccaaacccacctcctgaggagacctccacaggaacccaatcg
acttacagcacaatgggcacagtttccaggagaagaatctgcagaaccaacacaatggca
cgagccaagattcttcaggacatagacagagagcttgatcttgtggagagagaatctgca
aagcttagaaagaaacaagcagaacttgatgaggaagaaaaggagattgatgccaagtta
cggtacctggaaatgggaattaacaggaggaaagaggcattattaaaggagagagaaaag
agagagcgagcctacctccagggggtagccgaggatagggactacatgtctgacagtgag
gtgagcagcaccagaccaactcgaatagaaagtcagcatggcatagagcgaccaagaact
gctccccaaactgaattcagccagtttatacccccacaaacccaaacagaatctcaacca
gttcctcctacaagtccctatacacaataccagtactcttcccctgctcttcctacccaa
gcacccaccccatacacccagcaatcccattttcagcaacaaactttgtaccatcagcaa
gtttcaccttaccagactcaaccaacattccaagctgtggcaacaatgtccttcacacct
caagctcaatctacaccaactccacaaccttcttaccaattaccatcacagatgatggtg
atacaacaaaagccacggcaaactacattatatttggaacccaagataacttcaaactat
gaggtgattcgcaaccaacccctgatgatagcacctgtttctactgataatacatatgcg
gtttcccatcttggtagtaagtacaatagcttagacttgagaataggattggaggagaga
agtagcatggtgagcagtccaatatcaagcatatctgcagattctttctatgcagatatt
gaccatcatactccaagaaattttgtgctaattgatgacattggagagattaccaaagga
acagcagcattaagcactgcatttagtcttcatgaaaaggatctgtcaaaaacagaccgt
ctgcttcgaaccactgaaacacggaggtctcaagatgtgacagattttctagcaccttta
cagacttcctctagaatgcatagttatgtgaaagcagaggaagatccaatggaggatcct
tatgagttaaagcttctgaaacatcagattaaacaagaattccgcagaggagcagagagc
ttagatcaccttgctggtctttcccattattatcatgccgatactagctatagacatttt
ccaaaatctgaaaaatacagcattagtcgactcacacttgaaaaacaagcagcaaagcaa
ctaccagcagccatactttatcaaaagcagtcaaagcataagaaatcactaatagaccct
aaaatatcaaaattttcacctattcaagaaagtagagaccttgaacctgattattcaagc
tatatgacttctagcacttcatcaattggtggaatttcttccagagcaaggcttcttcaa
gatgatatcacttttggcctcagaaaaaatattacagaccaacaaaaatttatgggatca
tctcttggtacaggactgggcacattaggaaatactatacggtcagctcttcaggaggaa
gcagataagccatacagtagtggcagcaggtccagaccttcgtccagaccttcttctgtg
tatgggcttgatttatcaatcaaaagagattcttccagctcttccctgagactgaaagct
caagaggctgaagctctagatgtttcctttagtcatgcatcaccttctagcagaactaag
cctaccagtttgccaattagccagagtagaggaagaataccaattgtagcccagaattct
gaagaagaaagtccactcagtcctgttggccagccaatgggaatggctagggctgcagct
ggacccctgccaccaatatctgcagacaccagagatcagtttggatcaagtcactcattg
cctgaagttcagcaacacatgcgagaagaatcacggactcgagggtatgaccgtgacata
gcattcatcatggatgacttccaacatgccatgtcagacagtgaagcctatcacctgcgt
cgtgaagaaacagattggtttgacaaacccagggagtctcgtttggaaaatggacatggt
ctggatcgaaaactaccagaaagattggtccactctagacctctcagtcaacatcaagag
caaattatacagatgaacggaaagactgtgcattacatctttcctcatgcaaggataaaa
ataacaagagactctaaagatcacacagtttcaggtaatggattaggaattagaattgtg
ggtggtaaagaaatccctggacatagtggagaaattggagcctatattgccaagattctt
cctgggggatgtgcagaacagacagggagacttatagaagggatgcaagtattggaatgg
aatggaattcctttaacttctaaaacgtatgaagaagtgcagagtatcattagtcaacaa
agtggggaagcagaaatatgtgtaagactggacctcaacatgctctctgattctgaaaat
tcccaacacctggaacttcatgagccaacaaaagccgtggatagagcgaaatccccaggg
gttgatcctaagcaattggcagcggagcttcagaaggtttcactacagcagtcaccacta
gttctgtcatctgtcgttgaaaaaggatctcacgtgcattcaggtcctacttcagcagga
tccagttctgttcctagccctggacaaccagggtcaccctctgtgagcaaaaagaaacac
agcagcagcaagcctactgatgcaacaaaggttgtctctcatccaattacaggggaaatt
cagcttcaaatcaactatgatcttggaaatctcataatacatattctccaagcaagaaac
ctggtccctcgagacaacaatggttattctgacccctttgttaaagtgtatcttcttcca
ggacgtggtcaagtcatggttgtccagaatgcaagtgctgagtacaagagaaggactaaa
tatgttcagaaaagtcttaatcctgagtggaatcaaacagtaatttataagagtatctcc
atggaacagctcaagaagaaaacgctggaggtgacagtctgggattatgatagattttct
tccaatgactttcttggtgaggtattgattgatttatctagcacatctcacctcgataac
actcctaggtggtatcctctcaaagaacaaactgaaagcattgatcatggcaagtcccat
tccagtcaaagcagccagcagtccccaaagccatctgtcatcaaaagcagaagccatggt
atcttccctgacccatccaaggacatgcaggttcccaccattgagaaatcccatagtagt
cccggtagctcgaaatcctcatctgaaggtcatctccgctctcatggaccatctcgcagt
caaagcaaaaccagcgtcactcagacccacctggaagatgcaggggctgctatagccgct
gctgaagccgccgtgcaacaactccgccttcaaccaacaaagcctaccaatcaccggcct
gcagaaagctccgtgtccaccggctcctctggcagcagctttggcagtggctatagcgtg
gacagtgaaggaagcagcagcactgcaggggagactaatctatttcctattccaaggata
gggaagatggggcagaatggtcaagagcttataaaacagccaggagtaggagtgggacta
gcagacactgaagttaaaactcaggtaatgggagaaattaagattgcattgaagaaagaa
atgaaaacagatggtgaacaactaatagttgaaattcttcagtgcagaaatatcacctac
aaatttaaatctcctgatcacttaccagatttgtatgtaaaactctacgtaatgaacatc
tctacccaaaaaaaggtgatcaagaaaaaaacaagagtctgtagacatgatcgagagcct
tcattcaatgaaacttttagattcagcctaagccctgctggacactctcttcagatttta
cttttctccaatggagggaagtttatgaaaaagactttgattggtgaagcctgtatctgg
cttgacaaagtggatctcagaaaaagaatagtcaactggcacaaacttttggtcagtcct
actcaaacacattga

DBGET integrated database retrieval system