KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519778
Entry
107519778         CDS       T06036                                 

Gene name
ANO2
Definition
(RefSeq) anoctamin-2 isoform X1
  KO
K19497  anoctamin-2
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:ray00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    107519778 (ANO2)
Ion channels [BR:ray04040]
 Chloride channels
  Chloride channel, calcium-activated (CaCC)
   107519778 (ANO2)
SSDB
Motif
Pfam: Anoctamin Anoct_dimer
Other DBs
NCBI-GeneID: 107519778
NCBI-ProteinID: XP_016018250
LinkDB
Position
Unknown
AA seq 1058 aa
MVTPGGRNEAWDWLIILTVFFLLCSRLILCCLLPFIASGSSSIKWGTVTTSPSYQCRITF
FTPKDLPLLPGSPRRLSPRAVARGGQGLKHGKQCLKVPGPRAPGLQGTSNRDSGESSDGG
SSYSSSVINNYLDAGEARLSRMHFHDNQRKVDYVLAYHYRKRGAHPSHSSPGHALAIVSN
GEMGKEPHVGGPGDIELGPLDTLEEERKEQREEFEHNLMEAGLELEKDLESKSQGSVFVR
IHAPWQVLAREAEFLKIKVPTKKMYEIKSEGCIAKKFNEILQKLSSPLKPRVPEHSNNKM
KNLSYPFSREKMYLYNIQDKDTFFDNATRSRIVHEILKRTVCSRANNTMGINSLIANNIY
EAAYPLHDGEYDSPGDDMNDRKLLYQEWARYGVFYKFQPIDLIRKYFGEKIGLYFAWLGL
YTSFLIPSSVIGVIVFLYGCATIEEDIPSKEMCDQQNAFTMCPLCDKSCDYWNLSSACGT
ARASHLFDNPATVFFSIFMALWATMFLENWKRLQMRLGYFWDLTGIEEEEEHSRPEYETK
VREKMLKESDKSVVQKLGTDMMEREDEDDEDKLTWKDRFPGYLMNFASILFMIALTFSIV
FAVIVYRITTAAALSLNKATRSNVRVTVTATAVIINLVVILILDEIYGAVAKWLTKIEVP
KTEQTFEERLILKAFLLKFVNAYSPIFYVAFFKGRFVGRPGSYVYVFDGYRMEECAPGGC
LMELCIQLSIIMLGKQLIQNNIFEIGVPKLKKLFRKLKDETEPGETDSAHSKHPEQWDLD
YSLEPYTGLTPEYMEMIVQFGFVTLFVASFPLAPVFALLNNVIEVRLDAKKFVTELRRPD
AVRTKDIGIWFDILSGIGKFSVISNAFVIAITSDFIPRLVYQYSYSHNGTLHGFVNHTLS
FFNISQLKEGTQPENSQFDQEVQFCRFKDYREPPWAPNPYEFSKQYWSVLSARLAFVIIF
QNLVMFMSVLVDWMIPDIPTDISDQIKKEKSLLVDFFLKEEHEKLKLMDEPAPRSQGAGH
QSRRSRAGSSALSGRSQPGGMASSGSQHTNSGSQHTNV
NT seq 3177 nt   +upstreamnt  +downstreamnt
atggtcacgcctggtgggcggaacgaagcctgggattggttaataatacttacggttttc
tttctgctctgctcccgactgattctgtgttgtctgctcccctttattgcctcgggctcc
tcatctataaagtggggaacagtcaccaccagcccatcttatcagtgtaggataacattc
ttcacaccaaaagatctccccctgctccctggctccccacgccggctgagccctcgggca
gtggccaggggcggccagggtctcaaacatggaaagcagtgcctcaaggtgccaggtccc
cgggcccctggtctgcagggcacttccaaccgagactctggcgagtcctctgatggaggg
agctcctacagcagctctgtcatcaacaactacctggatgccggcgaggcccgtctgagc
cgcatgcacttccatgacaaccagaggaaagtcgactatgtgcttgcctaccactaccgg
aaacgtggggcccaccccagccacagctcccccggccacgcgctggccattgtctccaat
ggggagatgggcaaggagccccacgttgggggccctggtgacattgagctggggccgctc
gacaccctggaggaggagaggaaggagcagcgggaggaatttgagcacaacctgatggag
gccgggctggagctcgagaaggacttggagagtaaaagccagggatccgtctttgtccgg
atacatgccccgtggcaggtgctggccagagaggcagaattcttgaagatcaaagttcct
accaagaaaatgtacgagatcaaatcagaaggctgcattgcaaagaagttcaacgagatt
ctgcagaagttgagctcgcccctgaagcccagagttccagagcatagtaacaacaagatg
aaaaacctgtcctatccattttccagggagaaaatgtacctgtacaacatccaggataag
gacactttctttgataatgccacccgtagccgcattgtgcacgagatcctgaagcgcaca
gtctgttctcgagccaacaacacgatgggtattaactctctgatagcaaacaatatctat
gaggccgcctatcctcttcatgatggtgaatatgatagtccgggggatgacatgaatgac
agaaagctgctgtatcaagaatgggcacgctacggagtgttttataagtttcaacctatt
gacctcatcagaaagtattttggagaaaaaattggactgtattttgcctggctgggatta
tatacatcattcctcatcccatcttctgtaattggggtgattgtatttctttatggatgt
gcaacaattgaagaagatattcccagcaaagagatgtgtgaccagcagaatgccttcacc
atgtgtcctctgtgtgacaaatcctgtgactattggaacctcagctcagcctgtggtacg
gcgcgggccagccacctgtttgacaacccagccaccgtcttcttctccatcttcatggct
ttgtgggctaccatgtttcttgaaaactggaagagattacagatgcgactgggctacttc
tgggacctgactggtatagaagaggaagaagaacactcccggcctgagtatgaaaccaaa
gttcgagagaaaatgctaaaggagagtgacaaatcagttgtccagaaattggggaccgat
atgatggagagggaagatgaggatgatgaagataagctcacctggaaagatcgtttccca
ggttatctgatgaacttcgcctccatcttgttcatgattgccctgacattctcgattgtc
tttgcggtcattgtgtatcgcatcacaacggcagctgctctgtctctcaacaaggccaca
cgctccaatgtccgggtgacagtgacagctacagcggtcatcatcaacctcgtggtcatc
ctcatcctggatgagatctatggcgccgtggccaagtggctcaccaaaatcgaggtcccg
aaaacagaacagacttttgaagaacgcctaatactcaaagctttcttgctaaagtttgtc
aatgcctactcacccatcttctatgtggcctttttcaaggggaggtttgtgggcagacct
ggaagctatgtttatgtgttcgatggttaccgcatggaagagtgtgctcctggaggctgc
ctcatggagctctgcattcagctcagcatcatcatgttggggaagcagttaattcagaac
aacatctttgagatcggagtcccgaagctaaagaaactatttcggaagctgaaagatgag
acggaacctggagaaactgactcagcccattcaaagcatccagaacagtgggacctagac
tacagcttggaaccatacactgggctgactccagagtacatggaaatgattgtccagttt
ggcttcgtcaccctctttgtggcttcctttcctctggcacctgtgtttgccctcctgaac
aatgttattgaagtgcggctcgatgcaaagaagtttgtcacagagctgagacgaccagat
gctgtgagaaccaaagatatcgggatttggtttgacattctctctggaatcggcaagttc
tctgttatcagcaatgctttcgtcattgccatcacctctgactttatcccccgccttgtg
taccagtactcctatagtcacaacgggactctacatggctttgtcaaccacactctctcc
tttttcaacatcagccagctgaaggagggaacgcaacccgaaaattcacagttcgaccag
gaggttcagttttgcaggtttaaggattaccgagagccgccatgggccccaaacccatat
gagttttccaaacagtactggtctgttctgtccgcccgtctggcttttgtcataatcttc
cagaacctggtgatgttcatgagcgtcctcgtggactggatgatcccagatatccccacg
gacatcagcgaccagatcaagaaagaaaagagcttgttggtggacttcttcctgaaagag
gagcacgagaagctcaagctgatggatgagccggcccccaggagccagggagcggggcat
cagagcaggaggagccgggcgggcagctcggcactctcgggccgaagccagccgggcggc
atggcgtcctcggggtctcagcacaccaactccgggtctcagcacaccaacgtgtga

DBGET integrated database retrieval system