KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519788
Entry
107519788         CDS       T06036                                 

Gene name
TNFRSF1A
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 1A isoform X1
  KO
K03158  tumor necrosis factor receptor superfamily member 1A
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray04010  MAPK signaling pathway
ray04060  Cytokine-cytokine receptor interaction
ray04061  Viral protein interaction with cytokine and cytokine receptor
ray04064  NF-kappa B signaling pathway
ray04071  Sphingolipid signaling pathway
ray04150  mTOR signaling pathway
ray04210  Apoptosis
ray04215  Apoptosis - multiple species
ray04217  Necroptosis
ray04380  Osteoclast differentiation
ray04668  TNF signaling pathway
ray04920  Adipocytokine signaling pathway
ray04931  Insulin resistance
ray04932  Non-alcoholic fatty liver disease
ray05010  Alzheimer disease
ray05014  Amyotrophic lateral sclerosis
ray05022  Pathways of neurodegeneration - multiple diseases
ray05132  Salmonella infection
ray05142  Chagas disease
ray05145  Toxoplasmosis
ray05152  Tuberculosis
ray05160  Hepatitis C
ray05163  Human cytomegalovirus infection
ray05164  Influenza A
ray05165  Human papillomavirus infection
ray05166  Human T-cell leukemia virus 1 infection
ray05167  Kaposi sarcoma-associated herpesvirus infection
ray05168  Herpes simplex virus 1 infection
ray05170  Human immunodeficiency virus 1 infection
ray05171  Coronavirus disease - COVID-19
ray05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107519788 (TNFRSF1A)
   04064 NF-kappa B signaling pathway
    107519788 (TNFRSF1A)
   04668 TNF signaling pathway
    107519788 (TNFRSF1A)
   04071 Sphingolipid signaling pathway
    107519788 (TNFRSF1A)
   04150 mTOR signaling pathway
    107519788 (TNFRSF1A)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    107519788 (TNFRSF1A)
   04061 Viral protein interaction with cytokine and cytokine receptor
    107519788 (TNFRSF1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    107519788 (TNFRSF1A)
   04215 Apoptosis - multiple species
    107519788 (TNFRSF1A)
   04217 Necroptosis
    107519788 (TNFRSF1A)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    107519788 (TNFRSF1A)
  09158 Development and regeneration
   04380 Osteoclast differentiation
    107519788 (TNFRSF1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    107519788 (TNFRSF1A)
   05014 Amyotrophic lateral sclerosis
    107519788 (TNFRSF1A)
   05022 Pathways of neurodegeneration - multiple diseases
    107519788 (TNFRSF1A)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    107519788 (TNFRSF1A)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    107519788 (TNFRSF1A)
   04931 Insulin resistance
    107519788 (TNFRSF1A)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107519788 (TNFRSF1A)
   05152 Tuberculosis
    107519788 (TNFRSF1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    107519788 (TNFRSF1A)
   05170 Human immunodeficiency virus 1 infection
    107519788 (TNFRSF1A)
   05160 Hepatitis C
    107519788 (TNFRSF1A)
   05171 Coronavirus disease - COVID-19
    107519788 (TNFRSF1A)
   05164 Influenza A
    107519788 (TNFRSF1A)
   05168 Herpes simplex virus 1 infection
    107519788 (TNFRSF1A)
   05163 Human cytomegalovirus infection
    107519788 (TNFRSF1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    107519788 (TNFRSF1A)
   05165 Human papillomavirus infection
    107519788 (TNFRSF1A)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    107519788 (TNFRSF1A)
   05142 Chagas disease
    107519788 (TNFRSF1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ray04050]
    107519788 (TNFRSF1A)
   04090 CD molecules [BR:ray04090]
    107519788 (TNFRSF1A)
Cytokine receptors [BR:ray04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   107519788 (TNFRSF1A)
CD molecules [BR:ray04090]
 Proteins
  107519788 (TNFRSF1A)
SSDB
Motif
Pfam: TNFR_c6 Death
Other DBs
NCBI-GeneID: 107519788
NCBI-ProteinID: XP_016018289
LinkDB
Position
Unknown
AA seq 458 aa
MGLPTVPGLLLPLVLLVLLVEIYPLGVTGLVPHLRDREKRDSFCPQGKYRHPKNKSICCT
KCHKGTYKYNDCPAPGLDTDCRECENGTYTATENYSIECHSCSICRKEMNQVEISPCRVD
RNTVCGCKKNQYRKYWNNDLFQCHDCSPCLNGTVQLECQERQDTRCACHTGFFLRENKCV
SCVNCQENTECTKLCQPISEPVINPQDTVLLPLVIFFGLCLLSLFMALICRFQRWTSKLH
SIVCGKSTPVKEGEPQPLTPAPGFGLTTGFSPIPVFCPSPNPAFTPSSALTPSSTYTPSS
TYTPGGWSKYQPESPPREMAPSHQGAGPLLTAAPVSTPIPTPLQKLEKSAHTRRPDADPA
TLYAVVDGVPPSRWKEFVRRLGLSEHEIERLELQNGRCLREAQYSMLATWRQRTPHQEAT
LELLGLVLRDMDLLGCLEDIEEALRSPVSLMPTPCKPR
NT seq 1377 nt   +upstreamnt  +downstreamnt
atgggcctccccaccgtgcctggcttgctgctgccactggtgctcctggttctgttggtg
gaaatataccccttaggggttactggactggtccctcacctcagggaccgggagaagaga
gacagcttttgtccgcagggaaaatacagacaccctaaaaataaatccatttgctgtacg
aagtgccacaaagggacctacaagtacaatgactgtccagccccggggctggacacggac
tgcagggagtgtgaaaacggcacctataccgctactgagaactactccatagaatgccat
agctgctcgatatgccgaaaagaaatgaaccaggtggagatttctccttgcagagtggac
cggaacactgtatgtggctgcaagaagaaccagtaccggaaatattggaataacgatctt
tttcagtgccacgactgcagcccttgcctcaatggcacggtgcaattggagtgccaggag
agacaggacaccagatgcgcctgccacacagggttctttctaagagagaacaaatgtgtg
tcctgtgttaactgtcaggaaaacacggagtgcacgaagttgtgccaacccatatctgaa
cctgttattaaccctcaggacacagtgctgttgcccctggtgatcttttttggtctctgc
cttttatccctcttcatggctttaatatgccgcttccaacggtggacgtccaagctccac
tccattgtttgtgggaaatcaacacctgtaaaagagggggagcctcagcccctgacccca
gccccaggcttcggcctcaccacgggcttcagtcccatcccggtcttctgtcccagcccc
aacccagccttcacccccagttccgccctcacccccagttccacctacacccccagttcc
acctacacccctggtggctggtccaagtaccagcctgaatcaccccccagagagatggcg
ccatcccaccagggggctggccccctcctcacagcggctccagtctccacccccatcccc
acccctcttcagaagctggagaagagcgcccacacacggcgcccagatgcagatcctgca
acgctgtacgcggtcgtggacggcgtgcccccgtcgcgctggaaggagttcgtgcggcgg
ctggggctgagtgagcacgagatcgagcggctggagctgcagaacgggcgctgcctgcgc
gaggcgcagtacagcatgctggcgacctggcggcagcgcacgccacaccaggaggccaca
ctggagctgctgggccttgtgctccgcgacatggacctgcttggctgcctggaggacatc
gaggaggcgctgcgtagccctgtctccctcatgcccacaccctgcaagccccgatga

DBGET integrated database retrieval system