KEGG   Rousettus aegyptiacus (Egyptian rousette): 107519850
Entry
107519850         CDS       T06036                                 

Gene name
TYRP1
Definition
(RefSeq) LOW QUALITY PROTEIN: 5,6-dihydroxyindole-2-carboxylic acid oxidase
  KO
K00506  tyrosinase-related protein 1 [EC:1.14.18.-]
Organism
ray  Rousettus aegyptiacus (Egyptian rousette)
Pathway
ray00350  Tyrosine metabolism
ray01100  Metabolic pathways
ray04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:ray00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    107519850 (TYRP1)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    107519850 (TYRP1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ray04147]
    107519850 (TYRP1)
Enzymes [BR:ray01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.-  
     107519850 (TYRP1)
Exosome [BR:ray04147]
 Exosomal proteins
  Exosomal proteins of melanoma cells
   107519850 (TYRP1)
SSDB
Motif
Pfam: Tyrosinase Sigma_reg_N Comm Laminin_EGF
Other DBs
NCBI-GeneID: 107519850
NCBI-ProteinID: XP_016018430
LinkDB
Position
Unknown
AA seq 476 aa
MKDHKLLCLGCIFLPLFFFQQTWAQFPRECATIEALRNGVCCPDLSALSGPGTDLCGSSS
GRGRCEAVTADFRPHSPLYPHDGRDDREGWPTRFFNRTCHCNGNFSGHNCGTCRPGWRGA
ACDERILTVRRNLLDLSTEEKNYFVQALDMAKRTTHPQFVIATRRSEEILGPDGNTPQFE
NISIYNYFVWTHYYSVKKTFLGAGQESFGEVDFSHEGPAFLTWHRYHLLQLERDMQEMLR
NPSFSLPYWNFATGKNTCDICTDDLMGSRSNFDSNLISPNSVFSQWRVVCESLEDYDTLG
TLCNSTEGGPIRRNPAGNVARPMVQRLPEPQDVARCLEVGLFDTPPFYSNSTNSFRNTVE
DISTFPLKMPLIIDNNQIWYAFWPPITNIEMFVTAPDNLGYTYEVQWPSRNFSISEIVTI
AVVAALLLVAVVFVGASCLIRAKSNMDEANQPLLTDQYRDYAEEYEKIQNPNQSMV
NT seq 1431 nt   +upstreamnt  +downstreamnt
atgaaagatcataaactcctctgtctgggatgtatcttcttgcccctgtttttttttcag
cagacttgggctcaatttccaagagagtgtgccaccatcgaagctttgagaaatggtgta
tgttgcccagacctgtctgcattgtctgggcctggaactgacctctgtggctcatcatca
gggaggggcaggtgtgaagcagtgactgcagacttcagaccccacagccccctgtaccct
catgatggcagagatgatcgagaaggctggcccacacggttcttcaataggacatgccac
tgcaacggcaacttctcaggacacaactgtgggacctgccgtcccggatggagaggagct
gcctgtgacgaaaggattctcacagtcaggagaaaccttctggacttaagtacagaagaa
aagaactactttgtccaggccttggatatggcaaagcgtacaactcaccctcagtttgtc
attgctaccaggagatcagaagaaatattggggccagatggcaacacaccacaatttgag
aacatttccatttataactactttgtttggacacactattactcagtcaagaagactttc
cttggagcaggacaggaaagctttggtgaagtggatttctcccatgaaggaccagctttt
ctcacatggcacaggtatcacctattgcagttggagagagacatgcaggaaatgctgcgg
aatccttctttctcccttccttactggaattttgcaactgggaagaacacctgtgacatc
tgcaccgatgacttgatgggatcgagaagcaactttgattccaatcttataagcccgaac
tctgtcttttctcaatggagagtggtctgtgaatccttggaagattatgatactctagga
actctttgtaacagcactgagggtgggccaattaggagaaatccagctggaaatgtggct
agaccaatggtgcaacgtcttcctgaaccacaggatgtcgctcggtgcttggaagttggt
ttatttgacacacctcctttttattctaattctacaaacagtttccgaaacacagtagaa
gatatatccacatttccactgaaaatgcccctaataatagacaataatcagatatggtac
gcattctggcctccaattaccaacatagaaatgtttgttacggctccagacaatttggga
tatacttatgaagttcaatggccaagtcggaattttagtatttctgagattgttacaata
gcagtagttgctgctttattactggttgcagtcgtttttgttggtgcttcttgtctgatt
cgtgccaaaagcaacatggatgaagcaaatcagcctctccttactgatcagtatcgagac
tacgctgaagaatatgaaaaaatccagaatcctaatcagtctatggtctaa

DBGET integrated database retrieval system